Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1024252..1024909 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A264VM08 |
| Locus tag | L3Q80_RS04870 | Protein ID | WP_036958456.1 |
| Coordinates | 1024252..1024662 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | D4C097 |
| Locus tag | L3Q80_RS04875 | Protein ID | WP_004261864.1 |
| Coordinates | 1024643..1024909 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS04850 (L3Q80_04845) | 1020145..1021878 | - | 1734 | WP_112307214.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| L3Q80_RS04855 (L3Q80_04850) | 1021888..1022592 | - | 705 | WP_096863312.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| L3Q80_RS04860 (L3Q80_04855) | 1022614..1023516 | - | 903 | WP_004261814.1 | site-specific tyrosine recombinase XerD | - |
| L3Q80_RS04865 (L3Q80_04860) | 1023634..1024152 | + | 519 | WP_094963000.1 | flavodoxin FldB | - |
| L3Q80_RS04870 (L3Q80_04865) | 1024252..1024662 | - | 411 | WP_036958456.1 | protein YgfX | Toxin |
| L3Q80_RS04875 (L3Q80_04870) | 1024643..1024909 | - | 267 | WP_004261864.1 | FAD assembly factor SdhE | Antitoxin |
| L3Q80_RS04880 (L3Q80_04875) | 1025157..1026140 | + | 984 | WP_181488242.1 | tRNA-modifying protein YgfZ | - |
| L3Q80_RS04885 (L3Q80_04880) | 1026152..1026772 | + | 621 | WP_004261871.1 | HD domain-containing protein | - |
| L3Q80_RS04890 (L3Q80_04885) | 1027017..1027913 | + | 897 | WP_181488244.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15568.53 Da Isoelectric Point: 10.7733
>T246595 WP_036958456.1 NZ_CP098040:c1024662-1024252 [Providencia rettgeri]
VVLWKSNLSISWKTQLFSTCVHGVIGMFLLLAPWSPGNSMIWLPLLVVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWRILKAPWLTRYGILLTLEALQGKPQKLHLWVAKDALSEENWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCVHGVIGMFLLLAPWSPGNSMIWLPLLVVVVASWAKSQKNISKIKGVAVLVNGNKVQWKKN
EWRILKAPWLTRYGILLTLEALQGKPQKLHLWVAKDALSEENWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A264VM08 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A345M2Q5 |