Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 767840..768375 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | L3Q80_RS03755 | Protein ID | WP_144141264.1 |
| Coordinates | 768067..768375 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | D4BV21 |
| Locus tag | L3Q80_RS03750 | Protein ID | WP_004255691.1 |
| Coordinates | 767840..768067 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS03730 (L3Q80_03725) | 763123..763563 | + | 441 | WP_004255682.1 | flagellar export chaperone FlgN | - |
| L3Q80_RS03740 (L3Q80_03735) | 764333..766432 | - | 2100 | WP_004255687.1 | flagellar biosynthesis protein FlhA | - |
| L3Q80_RS03745 (L3Q80_03740) | 766425..767576 | - | 1152 | WP_140170721.1 | flagellar biosynthesis protein FlhB | - |
| L3Q80_RS03750 (L3Q80_03745) | 767840..768067 | + | 228 | WP_004255691.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| L3Q80_RS03755 (L3Q80_03750) | 768067..768375 | + | 309 | WP_144141264.1 | CcdB family protein | Toxin |
| L3Q80_RS03760 (L3Q80_03755) | 768391..768948 | + | 558 | WP_144141262.1 | hypothetical protein | - |
| L3Q80_RS03765 (L3Q80_03760) | 768991..769197 | - | 207 | WP_272661075.1 | helix-turn-helix transcriptional regulator | - |
| L3Q80_RS03770 (L3Q80_03765) | 769395..770033 | - | 639 | WP_094961165.1 | protein phosphatase CheZ | - |
| L3Q80_RS03775 (L3Q80_03770) | 770058..770450 | - | 393 | WP_004255705.1 | chemotaxis response regulator CheY | - |
| L3Q80_RS03780 (L3Q80_03775) | 770492..771559 | - | 1068 | WP_094961164.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| L3Q80_RS03785 (L3Q80_03780) | 771559..772395 | - | 837 | WP_094961163.1 | CheR family methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11757.87 Da Isoelectric Point: 8.0469
>T246594 WP_144141264.1 NZ_CP098040:768067-768375 [Providencia rettgeri]
MQYRLYQNRDDAIKYPYLLDIQSNIIDLLNTRLVIPLFDSRLVKKPLPARLTPQLVINGQVFILMTHQMACVPHSLLGKE
IVDLSSQRDTIKHAIDLLIDGF
MQYRLYQNRDDAIKYPYLLDIQSNIIDLLNTRLVIPLFDSRLVKKPLPARLTPQLVINGQVFILMTHQMACVPHSLLGKE
IVDLSSQRDTIKHAIDLLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|