Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 251666..252582 | Replicon | chromosome |
| Accession | NZ_CP098040 | ||
| Organism | Providencia rettgeri strain 18004577 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | D4BTW9 |
| Locus tag | L3Q80_RS01220 | Protein ID | WP_004254505.1 |
| Coordinates | 252124..252582 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | L3Q80_RS01215 | Protein ID | WP_181487862.1 |
| Coordinates | 251666..252127 (+) | Length | 154 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3Q80_RS01185 (L3Q80_01180) | 247329..247943 | + | 615 | WP_004254484.1 | LysE family translocator | - |
| L3Q80_RS01190 (L3Q80_01185) | 247973..248446 | - | 474 | WP_036957747.1 | NUDIX domain-containing protein | - |
| L3Q80_RS01195 (L3Q80_01190) | 248798..249439 | - | 642 | WP_004254492.1 | leucine efflux protein LeuE | - |
| L3Q80_RS01200 (L3Q80_01195) | 249949..250611 | + | 663 | WP_282553829.1 | AzlC family ABC transporter permease | - |
| L3Q80_RS01205 (L3Q80_01200) | 250608..250922 | + | 315 | WP_094960595.1 | AzlD domain-containing protein | - |
| L3Q80_RS01210 (L3Q80_01205) | 251110..251577 | + | 468 | WP_036957750.1 | DUF1456 family protein | - |
| L3Q80_RS01215 (L3Q80_01210) | 251666..252127 | + | 462 | WP_181487862.1 | DUF2384 domain-containing protein | Antitoxin |
| L3Q80_RS01220 (L3Q80_01215) | 252124..252582 | + | 459 | WP_004254505.1 | RES domain-containing protein | Toxin |
| L3Q80_RS01225 (L3Q80_01220) | 252583..253473 | - | 891 | WP_094960598.1 | LysR family transcriptional regulator | - |
| L3Q80_RS01230 (L3Q80_01225) | 253519..254478 | - | 960 | WP_094960599.1 | acetyl-CoA carboxylase carboxyl transferase subunit alpha | - |
| L3Q80_RS01235 (L3Q80_01230) | 254584..254934 | - | 351 | WP_232368671.1 | MerR family DNA-binding protein | - |
| L3Q80_RS01240 (L3Q80_01235) | 255035..255562 | - | 528 | WP_036957752.1 | GNAT family N-acetyltransferase | - |
| L3Q80_RS01245 (L3Q80_01240) | 255579..257045 | - | 1467 | WP_112307052.1 | AMP nucleosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17088.65 Da Isoelectric Point: 6.2048
>T246593 WP_004254505.1 NZ_CP098040:252124-252582 [Providencia rettgeri]
MILYRLVKSNFAHDAWSGQGAMLYGGRWNHKGTPAVYTSTSISLATLEILVHINQDILLSQFSLLSIDINDKYVMKLSLD
HLPTDWQQDPAPTSTMDIGTIWLNNQDSLALLIPSCIVPYEYNAIINPLHPQFQKALHTVKPLDFSVDPRLA
MILYRLVKSNFAHDAWSGQGAMLYGGRWNHKGTPAVYTSTSISLATLEILVHINQDILLSQFSLLSIDINDKYVMKLSLD
HLPTDWQQDPAPTSTMDIGTIWLNNQDSLALLIPSCIVPYEYNAIINPLHPQFQKALHTVKPLDFSVDPRLA
Download Length: 459 bp
Antitoxin
Download Length: 154 a.a. Molecular weight: 17086.58 Da Isoelectric Point: 9.9140
>AT246593 WP_181487862.1 NZ_CP098040:251666-252127 [Providencia rettgeri]
MRNYIPTPPLQPTASSFKPLWRHVGLPAERGIELTHFLRQGLSVSVLDNIQEWSGMSKTELLRISGINERNIARRKNAGQ
PLNADESERIARLVRVFDAAVRLFNGDKHAASDWLNHPVKGLGHLRPIELIATESGAIEVIDLIGRIEHGVFS
MRNYIPTPPLQPTASSFKPLWRHVGLPAERGIELTHFLRQGLSVSVLDNIQEWSGMSKTELLRISGINERNIARRKNAGQ
PLNADESERIARLVRVFDAAVRLFNGDKHAASDWLNHPVKGLGHLRPIELIATESGAIEVIDLIGRIEHGVFS
Download Length: 462 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|