Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 508841..509477 | Replicon | chromosome |
Accession | NZ_CP098036 | ||
Organism | Bacillus subtilis strain SPC-17-3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NBY72_RS02615 | Protein ID | WP_003156187.1 |
Coordinates | 509127..509477 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NBY72_RS02610 | Protein ID | WP_003225183.1 |
Coordinates | 508841..509122 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY72_RS02590 (NBY72_02590) | 505200..505799 | - | 600 | WP_014478896.1 | rhomboid family intramembrane serine protease | - |
NBY72_RS02595 (NBY72_02595) | 505894..506259 | + | 366 | WP_014478897.1 | holo-ACP synthase | - |
NBY72_RS02600 (NBY72_02600) | 506425..507441 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
NBY72_RS02605 (NBY72_02605) | 507556..508725 | + | 1170 | WP_014478898.1 | alanine racemase | - |
NBY72_RS02610 (NBY72_02610) | 508841..509122 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NBY72_RS02615 (NBY72_02615) | 509127..509477 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NBY72_RS02620 (NBY72_02620) | 509593..510417 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NBY72_RS02625 (NBY72_02625) | 510422..510787 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NBY72_RS02630 (NBY72_02630) | 510791..511192 | + | 402 | WP_014478899.1 | serine/threonine-protein kinase RsbT | - |
NBY72_RS02635 (NBY72_02635) | 511204..512211 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
NBY72_RS02640 (NBY72_02640) | 512280..512609 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NBY72_RS02645 (NBY72_02645) | 512606..513088 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NBY72_RS02650 (NBY72_02650) | 513054..513842 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
NBY72_RS02655 (NBY72_02655) | 513842..514441 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T246591 WP_003156187.1 NZ_CP098036:509127-509477 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|