Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1390538..1391066 | Replicon | chromosome |
| Accession | NZ_CP098034 | ||
| Organism | Vibrio alginolyticus strain E110 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NAL94_RS14990 | Protein ID | WP_042524283.1 |
| Coordinates | 1390538..1390828 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A347UR02 |
| Locus tag | NAL94_RS14995 | Protein ID | WP_005377003.1 |
| Coordinates | 1390818..1391066 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAL94_RS14935 (NAL94_14940) | 1386462..1386555 | + | 94 | Protein_1300 | DUF3265 domain-containing protein | - |
| NAL94_RS14940 (NAL94_14945) | 1386942..1387031 | + | 90 | WP_206225637.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14945 (NAL94_14950) | 1387068..1387409 | + | 342 | WP_169629192.1 | hypothetical protein | - |
| NAL94_RS14950 (NAL94_14955) | 1387432..1387521 | + | 90 | WP_081604385.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14955 (NAL94_14960) | 1387558..1388055 | + | 498 | WP_005448066.1 | DNA topology modulation protein | - |
| NAL94_RS14960 (NAL94_14965) | 1388073..1388162 | + | 90 | WP_075984317.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14965 (NAL94_14970) | 1388195..1388515 | + | 321 | WP_042524135.1 | hypothetical protein | - |
| NAL94_RS14970 (NAL94_14975) | 1389216..1389344 | + | 129 | WP_155396220.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14975 (NAL94_14980) | 1389565..1389753 | + | 189 | WP_225495367.1 | hypothetical protein | - |
| NAL94_RS14980 (NAL94_14985) | 1389833..1389910 | + | 78 | Protein_1309 | DUF3265 domain-containing protein | - |
| NAL94_RS14985 (NAL94_14990) | 1389996..1390391 | + | 396 | WP_042524285.1 | ACT domain-containing protein | - |
| NAL94_RS14990 (NAL94_14995) | 1390538..1390828 | - | 291 | WP_042524283.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NAL94_RS14995 (NAL94_15000) | 1390818..1391066 | - | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NAL94_RS15000 (NAL94_15005) | 1391123..1391209 | + | 87 | WP_225492314.1 | DUF3265 domain-containing protein | - |
| NAL94_RS15005 (NAL94_15010) | 1391260..1391859 | + | 600 | WP_054866200.1 | hypothetical protein | - |
| NAL94_RS15010 (NAL94_15015) | 1391859..1391921 | + | 63 | Protein_1315 | DUF3265 domain-containing protein | - |
| NAL94_RS15015 (NAL94_15020) | 1392027..1392392 | + | 366 | WP_042524341.1 | DUF6404 family protein | - |
| NAL94_RS15020 (NAL94_15025) | 1392410..1392499 | + | 90 | WP_080254104.1 | DUF3265 domain-containing protein | - |
| NAL94_RS15025 (NAL94_15030) | 1392532..1392918 | + | 387 | WP_230623518.1 | hydrolase | - |
| NAL94_RS15030 (NAL94_15035) | 1392925..1393059 | + | 135 | WP_005377070.1 | DUF3265 domain-containing protein | - |
| NAL94_RS15035 (NAL94_15040) | 1393119..1393598 | - | 480 | WP_021033918.1 | hypothetical protein | - |
| NAL94_RS15040 (NAL94_15045) | 1393866..1394387 | + | 522 | WP_005377075.1 | GNAT family N-acetyltransferase | - |
| NAL94_RS15045 (NAL94_15050) | 1394492..1394893 | + | 402 | WP_005377076.1 | DUF2007 domain-containing protein | - |
| NAL94_RS15050 (NAL94_15055) | 1395037..1395645 | + | 609 | WP_005389306.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1302066..1402830 | 100764 | |
| - | inside | Integron | - | - | 1302583..1392918 | 90335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11291.28 Da Isoelectric Point: 10.5932
>T246590 WP_042524283.1 NZ_CP098034:c1390828-1390538 [Vibrio alginolyticus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSSYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSSYRLVYKVEDDVIIVTVLAVGK
RERSDVYRKAMKRLDD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|