Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 1329019..1329578 | Replicon | chromosome |
| Accession | NZ_CP098034 | ||
| Organism | Vibrio alginolyticus strain E110 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NAL94_RS14355 | Protein ID | WP_069543266.1 |
| Coordinates | 1329019..1329297 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A347UR21 |
| Locus tag | NAL94_RS14360 | Protein ID | WP_005398409.1 |
| Coordinates | 1329294..1329578 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAL94_RS14295 (NAL94_14295) | 1324636..1325022 | + | 387 | WP_250690222.1 | hypothetical protein | - |
| NAL94_RS14300 (NAL94_14300) | 1325121..1325462 | + | 342 | WP_053320200.1 | SH3 domain-containing protein | - |
| NAL94_RS14305 (NAL94_14305) | 1325429..1325569 | + | 141 | WP_080659271.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14310 (NAL94_14310) | 1325602..1326267 | + | 666 | WP_206225575.1 | hypothetical protein | - |
| NAL94_RS14315 (NAL94_14315) | 1326372..1326635 | + | 264 | WP_238951979.1 | hypothetical protein | - |
| NAL94_RS14320 (NAL94_14320) | 1326678..1326884 | + | 207 | WP_238952355.1 | GNAT family N-acetyltransferase | - |
| NAL94_RS14325 (NAL94_14325) | 1326899..1326961 | + | 63 | WP_079749016.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14330 (NAL94_14330) | 1327025..1327711 | + | 687 | WP_206225574.1 | DUF4145 domain-containing protein | - |
| NAL94_RS14335 (NAL94_14335) | 1327693..1327818 | + | 126 | WP_241092770.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14340 (NAL94_14340) | 1328340..1328429 | + | 90 | WP_206225644.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14345 (NAL94_14345) | 1328462..1328863 | + | 402 | WP_005377049.1 | HIT family protein | - |
| NAL94_RS14350 (NAL94_14350) | 1328898..1328990 | + | 93 | WP_080276993.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14355 (NAL94_14355) | 1329019..1329297 | - | 279 | WP_069543266.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| NAL94_RS14360 (NAL94_14360) | 1329294..1329578 | - | 285 | WP_005398409.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NAL94_RS14365 (NAL94_14365) | 1329655..1329746 | + | 92 | Protein_1186 | DUF3265 domain-containing protein | - |
| NAL94_RS14370 (NAL94_14370) | 1329783..1330334 | + | 552 | WP_191116430.1 | ADP-ribosyltransferase | - |
| NAL94_RS14375 (NAL94_14375) | 1330357..1330422 | + | 66 | Protein_1188 | DUF3265 domain-containing protein | - |
| NAL94_RS14380 (NAL94_14380) | 1330854..1330943 | + | 90 | WP_206225637.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14385 (NAL94_14385) | 1330968..1331354 | - | 387 | WP_064368483.1 | hypothetical protein | - |
| NAL94_RS14390 (NAL94_14390) | 1331341..1331667 | - | 327 | WP_020840765.1 | hypothetical protein | - |
| NAL94_RS14395 (NAL94_14395) | 1331950..1332540 | + | 591 | WP_206225573.1 | hypothetical protein | - |
| NAL94_RS14400 (NAL94_14400) | 1333783..1334277 | + | 495 | WP_206225572.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1302066..1402830 | 100764 | |
| - | inside | Integron | - | - | 1302583..1392918 | 90335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10892.52 Da Isoelectric Point: 4.1856
>T246589 WP_069543266.1 NZ_CP098034:c1329297-1329019 [Vibrio alginolyticus]
MILWEEESLNDREEIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
MILWEEESLNDREEIFEFLYDFNPDAAEKTDNLIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGDIIRVM
RVLHQKQKFPTD
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|