Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1319563..1320110 Replicon chromosome
Accession NZ_CP098034
Organism Vibrio alginolyticus strain E110

Toxin (Protein)


Gene name relE Uniprot ID A0A7Y0N042
Locus tag NAL94_RS14225 Protein ID WP_042524232.1
Coordinates 1319808..1320110 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7Y0N039
Locus tag NAL94_RS14220 Protein ID WP_042524229.1
Coordinates 1319563..1319820 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NAL94_RS14150 (NAL94_14150) 1315076..1315165 + 90 WP_074531724.1 DUF3265 domain-containing protein -
NAL94_RS14155 (NAL94_14155) 1315208..1315798 + 591 WP_186584880.1 cold shock and DUF1294 domain-containing protein -
NAL94_RS14160 (NAL94_14160) 1315837..1315929 + 93 WP_005448238.1 DUF3265 domain-containing protein -
NAL94_RS14165 (NAL94_14165) 1316029..1316331 - 303 WP_045389929.1 hypothetical protein -
NAL94_RS14170 (NAL94_14170) 1316418..1316549 + 132 WP_082038756.1 DUF3265 domain-containing protein -
NAL94_RS14175 (NAL94_14175) 1316968..1317096 + 129 WP_077200588.1 DUF3265 domain-containing protein -
NAL94_RS14180 (NAL94_14180) 1317178..1317435 + 258 WP_199449604.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NAL94_RS14185 (NAL94_14185) 1317423..1317725 + 303 WP_010448451.1 type II toxin-antitoxin system RelE/ParE family toxin -
NAL94_RS14190 (NAL94_14190) 1317761..1317853 + 93 WP_004749071.1 DUF3265 domain-containing protein -
NAL94_RS14195 (NAL94_14195) 1317887..1318291 + 405 WP_025624180.1 hypothetical protein -
NAL94_RS14200 (NAL94_14200) 1318306..1318398 + 93 WP_079881479.1 DUF3265 domain-containing protein -
NAL94_RS14205 (NAL94_14205) 1318427..1318762 + 336 WP_042524632.1 TonB family protein -
NAL94_RS14210 (NAL94_14210) 1318766..1318876 + 111 WP_169629201.1 DUF3265 domain-containing protein -
NAL94_RS14215 (NAL94_14215) 1318909..1319403 + 495 WP_005377068.1 GNAT family N-acetyltransferase -
NAL94_RS14220 (NAL94_14220) 1319563..1319820 + 258 WP_042524229.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NAL94_RS14225 (NAL94_14225) 1319808..1320110 + 303 WP_042524232.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NAL94_RS14230 (NAL94_14230) 1320149..1320238 + 90 WP_079880725.1 DUF3265 domain-containing protein -
NAL94_RS14235 (NAL94_14235) 1320270..1320734 + 465 WP_169629193.1 hypothetical protein -
NAL94_RS14240 (NAL94_14240) 1320749..1320841 + 93 WP_081048899.1 DUF3265 domain-containing protein -
NAL94_RS14245 (NAL94_14245) 1320869..1321414 + 546 WP_086585476.1 hypothetical protein -
NAL94_RS14250 (NAL94_14250) 1321429..1321521 + 93 WP_005377014.1 DUF3265 domain-containing protein -
NAL94_RS14255 (NAL94_14255) 1321548..1321955 + 408 WP_025769012.1 hypothetical protein -
NAL94_RS14260 (NAL94_14260) 1321984..1322073 + 90 WP_080276999.1 DUF3265 domain-containing protein -
NAL94_RS14265 (NAL94_14265) 1322164..1322442 + 279 WP_115386111.1 hypothetical protein -
NAL94_RS14270 (NAL94_14270) 1322460..1322549 + 90 WP_079767000.1 DUF3265 domain-containing protein -
NAL94_RS14275 (NAL94_14275) 1322686..1322925 + 240 WP_042523958.1 hypothetical protein -
NAL94_RS14280 (NAL94_14280) 1323063..1323836 + 774 WP_054575577.1 NERD domain-containing protein -
NAL94_RS14285 (NAL94_14285) 1323851..1323943 + 93 WP_079380082.1 DUF3265 domain-containing protein -
NAL94_RS14290 (NAL94_14290) 1323975..1324493 + 519 WP_206225577.1 GNAT family N-acetyltransferase -
NAL94_RS14295 (NAL94_14295) 1324636..1325022 + 387 WP_250690222.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1302066..1402830 100764
- inside Integron - - 1302583..1392918 90335


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11696.59 Da        Isoelectric Point: 5.1765

>T246588 WP_042524232.1 NZ_CP098034:1319808-1320110 [Vibrio alginolyticus]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLNYREVVVNPCRVFYKQDGDKV
FILFVMRAERDIRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9592.07 Da        Isoelectric Point: 6.7273

>AT246588 WP_042524229.1 NZ_CP098034:1319563-1319820 [Vibrio alginolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKAVSHDEAKEKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Y0N042

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y0N039

References