Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 1317178..1317725 | Replicon | chromosome |
| Accession | NZ_CP098034 | ||
| Organism | Vibrio alginolyticus strain E110 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2K7SRN5 |
| Locus tag | NAL94_RS14185 | Protein ID | WP_010448451.1 |
| Coordinates | 1317423..1317725 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NAL94_RS14180 | Protein ID | WP_199449604.1 |
| Coordinates | 1317178..1317435 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAL94_RS14135 (NAL94_14135) | 1312241..1312327 | + | 87 | Protein_1140 | DUF3265 domain-containing protein | - |
| NAL94_RS14140 (NAL94_14140) | 1312422..1313273 | + | 852 | WP_206225578.1 | hypothetical protein | - |
| NAL94_RS14145 (NAL94_14145) | 1314455..1314544 | + | 90 | WP_075111319.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14150 (NAL94_14150) | 1315076..1315165 | + | 90 | WP_074531724.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14155 (NAL94_14155) | 1315208..1315798 | + | 591 | WP_186584880.1 | cold shock and DUF1294 domain-containing protein | - |
| NAL94_RS14160 (NAL94_14160) | 1315837..1315929 | + | 93 | WP_005448238.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14165 (NAL94_14165) | 1316029..1316331 | - | 303 | WP_045389929.1 | hypothetical protein | - |
| NAL94_RS14170 (NAL94_14170) | 1316418..1316549 | + | 132 | WP_082038756.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14175 (NAL94_14175) | 1316968..1317096 | + | 129 | WP_077200588.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14180 (NAL94_14180) | 1317178..1317435 | + | 258 | WP_199449604.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NAL94_RS14185 (NAL94_14185) | 1317423..1317725 | + | 303 | WP_010448451.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NAL94_RS14190 (NAL94_14190) | 1317761..1317853 | + | 93 | WP_004749071.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14195 (NAL94_14195) | 1317887..1318291 | + | 405 | WP_025624180.1 | hypothetical protein | - |
| NAL94_RS14200 (NAL94_14200) | 1318306..1318398 | + | 93 | WP_079881479.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14205 (NAL94_14205) | 1318427..1318762 | + | 336 | WP_042524632.1 | TonB family protein | - |
| NAL94_RS14210 (NAL94_14210) | 1318766..1318876 | + | 111 | WP_169629201.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14215 (NAL94_14215) | 1318909..1319403 | + | 495 | WP_005377068.1 | GNAT family N-acetyltransferase | - |
| NAL94_RS14220 (NAL94_14220) | 1319563..1319820 | + | 258 | WP_042524229.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NAL94_RS14225 (NAL94_14225) | 1319808..1320110 | + | 303 | WP_042524232.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NAL94_RS14230 (NAL94_14230) | 1320149..1320238 | + | 90 | WP_079880725.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14235 (NAL94_14235) | 1320270..1320734 | + | 465 | WP_169629193.1 | hypothetical protein | - |
| NAL94_RS14240 (NAL94_14240) | 1320749..1320841 | + | 93 | WP_081048899.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14245 (NAL94_14245) | 1320869..1321414 | + | 546 | WP_086585476.1 | hypothetical protein | - |
| NAL94_RS14250 (NAL94_14250) | 1321429..1321521 | + | 93 | WP_005377014.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14255 (NAL94_14255) | 1321548..1321955 | + | 408 | WP_025769012.1 | hypothetical protein | - |
| NAL94_RS14260 (NAL94_14260) | 1321984..1322073 | + | 90 | WP_080276999.1 | DUF3265 domain-containing protein | - |
| NAL94_RS14265 (NAL94_14265) | 1322164..1322442 | + | 279 | WP_115386111.1 | hypothetical protein | - |
| NAL94_RS14270 (NAL94_14270) | 1322460..1322549 | + | 90 | WP_079767000.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1302066..1402830 | 100764 | |
| - | inside | Integron | - | - | 1302583..1392918 | 90335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11625.52 Da Isoelectric Point: 5.1765
>T246587 WP_010448451.1 NZ_CP098034:1317423-1317725 [Vibrio alginolyticus]
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLGKQ
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLGKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|