Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH |
Location | 4305912..4306635 | Replicon | chromosome |
Accession | NZ_CP098030 | ||
Organism | Serratia ureilytica strain HNU47 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NAL25_RS20595 | Protein ID | WP_095099094.1 |
Coordinates | 4305912..4306298 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NAL25_RS20600 | Protein ID | WP_046899002.1 |
Coordinates | 4306291..4306635 (+) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL25_RS20570 (NAL25_20545) | 4301218..4301607 | - | 390 | WP_257711362.1 | DUF3224 domain-containing protein | - |
NAL25_RS20575 (NAL25_20550) | 4301843..4302682 | + | 840 | WP_257711364.1 | helix-turn-helix domain-containing protein | - |
NAL25_RS20585 (NAL25_20560) | 4303022..4304539 | - | 1518 | WP_004931697.1 | lysine--tRNA ligase | - |
NAL25_RS20595 (NAL25_20570) | 4305912..4306298 | + | 387 | WP_095099094.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NAL25_RS20600 (NAL25_20575) | 4306291..4306635 | + | 345 | WP_046899002.1 | helix-turn-helix domain-containing protein | Antitoxin |
NAL25_RS20605 (NAL25_20580) | 4306687..4308420 | - | 1734 | WP_033639478.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NAL25_RS20610 (NAL25_20585) | 4308427..4309143 | - | 717 | WP_042785306.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NAL25_RS20615 (NAL25_20590) | 4309170..4310069 | - | 900 | WP_033644935.1 | site-specific tyrosine recombinase XerD | - |
NAL25_RS20620 (NAL25_20595) | 4310176..4310694 | + | 519 | WP_257711372.1 | flavodoxin FldB | - |
NAL25_RS20625 (NAL25_20600) | 4310760..4311182 | - | 423 | WP_046899001.1 | protein YgfX | - |
NAL25_RS20630 (NAL25_20605) | 4311163..4311429 | - | 267 | WP_257711373.1 | FAD assembly factor SdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14621.64 Da Isoelectric Point: 8.4849
>T246583 WP_095099094.1 NZ_CP098030:4305912-4306298 [Serratia ureilytica]
MDIFVTDDFDKFMKKNRIVDQKICTAAHELEHGNHDGDLGGGVYKKRLPLNRGKRGGARSIVAFKHGRHQYFVDGWLKNT
VKQNGAKEINDDELATYRELAKDFLAMPPEIIKRAIDSGYLREVKCDD
MDIFVTDDFDKFMKKNRIVDQKICTAAHELEHGNHDGDLGGGVYKKRLPLNRGKRGGARSIVAFKHGRHQYFVDGWLKNT
VKQNGAKEINDDELATYRELAKDFLAMPPEIIKRAIDSGYLREVKCDD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|