Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3921101..3921757 | Replicon | chromosome |
Accession | NZ_CP098030 | ||
Organism | Serratia ureilytica strain HNU47 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NAL25_RS18805 | Protein ID | WP_046897729.1 |
Coordinates | 3921101..3921490 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NAL25_RS18810 | Protein ID | WP_019452401.1 |
Coordinates | 3921494..3921757 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL25_RS18790 (NAL25_18770) | 3917568..3918998 | + | 1431 | WP_046897726.1 | multidrug transporter subunit MdtD | - |
NAL25_RS18795 (NAL25_18775) | 3918995..3920377 | + | 1383 | WP_046897727.1 | two-component system sensor histidine kinase BaeS | - |
NAL25_RS18800 (NAL25_18780) | 3920377..3921093 | + | 717 | WP_257711160.1 | two-component system response regulator BaeR | - |
NAL25_RS18805 (NAL25_18785) | 3921101..3921490 | - | 390 | WP_046897729.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NAL25_RS18810 (NAL25_18790) | 3921494..3921757 | - | 264 | WP_019452401.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NAL25_RS18815 (NAL25_18795) | 3922095..3922433 | + | 339 | WP_033644064.1 | YegP family protein | - |
NAL25_RS18820 (NAL25_18800) | 3922612..3923964 | + | 1353 | WP_046897730.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
NAL25_RS18825 (NAL25_18805) | 3924181..3924402 | - | 222 | WP_152665227.1 | hypothetical protein | - |
NAL25_RS18830 (NAL25_18810) | 3924432..3925337 | + | 906 | WP_046897731.1 | lipid kinase YegS | - |
NAL25_RS18835 (NAL25_18815) | 3925598..3926647 | + | 1050 | WP_015378749.1 | class I fructose-bisphosphate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14336.56 Da Isoelectric Point: 7.3214
>T246582 WP_046897729.1 NZ_CP098030:c3921490-3921101 [Serratia ureilytica]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTH
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|