Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 3824968..3825530 | Replicon | chromosome |
Accession | NZ_CP098030 | ||
Organism | Serratia ureilytica strain HNU47 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | NAL25_RS18385 | Protein ID | WP_025303801.1 |
Coordinates | 3824968..3825324 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A8G2G5I1 |
Locus tag | NAL25_RS18390 | Protein ID | WP_004936539.1 |
Coordinates | 3825321..3825530 (-) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL25_RS18365 (NAL25_18345) | 3820709..3821500 | - | 792 | WP_182265500.1 | TonB family protein | - |
NAL25_RS18370 (NAL25_18350) | 3821603..3822442 | - | 840 | WP_257713199.1 | ChaN family lipoprotein | - |
NAL25_RS18375 (NAL25_18355) | 3822621..3824030 | + | 1410 | WP_046896238.1 | S-methylmethionine permease | - |
NAL25_RS18380 (NAL25_18360) | 3824020..3824958 | + | 939 | WP_046896237.1 | homocysteine S-methyltransferase | - |
NAL25_RS18385 (NAL25_18365) | 3824968..3825324 | - | 357 | WP_025303801.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NAL25_RS18390 (NAL25_18370) | 3825321..3825530 | - | 210 | WP_004936539.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NAL25_RS18395 (NAL25_18375) | 3825640..3827919 | - | 2280 | WP_016926766.1 | NADP-dependent oxaloacetate-decarboxylating malate dehydrogenase | - |
NAL25_RS18400 (NAL25_18380) | 3828135..3828308 | - | 174 | WP_004936544.1 | hypothetical protein | - |
NAL25_RS18405 (NAL25_18385) | 3828289..3828669 | - | 381 | WP_046896236.1 | DUF2570 family protein | - |
NAL25_RS18410 (NAL25_18390) | 3828666..3829067 | - | 402 | WP_182265501.1 | M15 family metallopeptidase | - |
NAL25_RS18415 (NAL25_18395) | 3829057..3829383 | - | 327 | WP_033643982.1 | phage holin, lambda family | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13163.93 Da Isoelectric Point: 4.9139
>T246581 WP_025303801.1 NZ_CP098030:c3825324-3824968 [Serratia ureilytica]
MIFLTAEDIAEFNAEIVPHGRQEGSKVEAVANRVLNAYHYENVTDVYRLAALYLIAISHGHIFLDGNKRTAFQSMALFLG
INGIALREDAELVEITVEAAQGRLNVEQAAEHLRRLTE
MIFLTAEDIAEFNAEIVPHGRQEGSKVEAVANRVLNAYHYENVTDVYRLAALYLIAISHGHIFLDGNKRTAFQSMALFLG
INGIALREDAELVEITVEAAQGRLNVEQAAEHLRRLTE
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|