Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3146879..3147510 | Replicon | chromosome |
Accession | NZ_CP098030 | ||
Organism | Serratia ureilytica strain HNU47 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NAL25_RS15210 | Protein ID | WP_094142813.1 |
Coordinates | 3146879..3147277 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NAL25_RS15215 | Protein ID | WP_046896588.1 |
Coordinates | 3147277..3147510 (-) | Length | 78 a.a. |
Genomic Context
Location: 3142454..3142828 (375 bp)
Type: Others
Protein ID: WP_182264261.1
Type: Others
Protein ID: WP_182264261.1
Location: 3142821..3143123 (303 bp)
Type: Others
Protein ID: WP_015378258.1
Type: Others
Protein ID: WP_015378258.1
Location: 3143126..3143530 (405 bp)
Type: Others
Protein ID: WP_033643530.1
Type: Others
Protein ID: WP_033643530.1
Location: 3143530..3145608 (2079 bp)
Type: Others
Protein ID: WP_103085412.1
Type: Others
Protein ID: WP_103085412.1
Location: 3145601..3146752 (1152 bp)
Type: Others
Protein ID: WP_019452962.1
Type: Others
Protein ID: WP_019452962.1
Location: 3146879..3147277 (399 bp)
Type: Toxin
Protein ID: WP_094142813.1
Type: Toxin
Protein ID: WP_094142813.1
Location: 3147277..3147510 (234 bp)
Type: Antitoxin
Protein ID: WP_046896588.1
Type: Antitoxin
Protein ID: WP_046896588.1
Location: 3147636..3148280 (645 bp)
Type: Others
Protein ID: WP_004934858.1
Type: Others
Protein ID: WP_004934858.1
Location: 3148291..3148680 (390 bp)
Type: Others
Protein ID: WP_004934862.1
Type: Others
Protein ID: WP_004934862.1
Location: 3148783..3149832 (1050 bp)
Type: Others
Protein ID: WP_046896587.1
Type: Others
Protein ID: WP_046896587.1
Location: 3149832..3150704 (873 bp)
Type: Others
Protein ID: WP_046896586.1
Type: Others
Protein ID: WP_046896586.1
Location: 3150742..3152358 (1617 bp)
Type: Others
Protein ID: WP_046896585.1
Type: Others
Protein ID: WP_046896585.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL25_RS15185 (NAL25_15165) | 3142454..3142828 | + | 375 | WP_182264261.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NAL25_RS15190 (NAL25_15170) | 3142821..3143123 | + | 303 | WP_015378258.1 | DNA-binding transcriptional regulator | - |
NAL25_RS15195 (NAL25_15175) | 3143126..3143530 | - | 405 | WP_033643530.1 | flagellar protein FlhE | - |
NAL25_RS15200 (NAL25_15180) | 3143530..3145608 | - | 2079 | WP_103085412.1 | flagellar biosynthesis protein FlhA | - |
NAL25_RS15205 (NAL25_15185) | 3145601..3146752 | - | 1152 | WP_019452962.1 | flagellar biosynthesis protein FlhB | - |
NAL25_RS15210 (NAL25_15190) | 3146879..3147277 | - | 399 | WP_094142813.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NAL25_RS15215 (NAL25_15195) | 3147277..3147510 | - | 234 | WP_046896588.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NAL25_RS15220 (NAL25_15200) | 3147636..3148280 | - | 645 | WP_004934858.1 | protein phosphatase CheZ | - |
NAL25_RS15225 (NAL25_15205) | 3148291..3148680 | - | 390 | WP_004934862.1 | chemotaxis response regulator CheY | - |
NAL25_RS15230 (NAL25_15210) | 3148783..3149832 | - | 1050 | WP_046896587.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
NAL25_RS15235 (NAL25_15215) | 3149832..3150704 | - | 873 | WP_046896586.1 | protein-glutamate O-methyltransferase CheR | - |
NAL25_RS15240 (NAL25_15220) | 3150742..3152358 | - | 1617 | WP_046896585.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14890.05 Da Isoelectric Point: 8.4955
>T246579 WP_094142813.1 NZ_CP098030:c3147277-3146879 [Serratia ureilytica]
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSVTYGELVHGVEKSSRPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVEGLRLENWL
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSVTYGELVHGVEKSSRPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVEGLRLENWL
Download Length: 399 bp