Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1585171..1585724 | Replicon | chromosome |
Accession | NZ_CP098030 | ||
Organism | Serratia ureilytica strain HNU47 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | NAL25_RS07685 | Protein ID | WP_046896980.1 |
Coordinates | 1585410..1585724 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A2V4GJ62 |
Locus tag | NAL25_RS07680 | Protein ID | WP_029988820.1 |
Coordinates | 1585171..1585407 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL25_RS07665 (NAL25_07655) | 1581637..1583172 | + | 1536 | WP_004938996.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
NAL25_RS07670 (NAL25_07660) | 1583225..1584145 | + | 921 | WP_046896979.1 | glutathione ABC transporter permease GsiC | - |
NAL25_RS07675 (NAL25_07665) | 1584155..1585063 | + | 909 | WP_193549762.1 | glutathione ABC transporter permease GsiD | - |
NAL25_RS07680 (NAL25_07670) | 1585171..1585407 | + | 237 | WP_029988820.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NAL25_RS07685 (NAL25_07675) | 1585410..1585724 | + | 315 | WP_046896980.1 | CcdB family protein | Toxin |
NAL25_RS07690 (NAL25_07680) | 1585762..1586604 | - | 843 | WP_015377214.1 | S-formylglutathione hydrolase | - |
NAL25_RS07695 (NAL25_07685) | 1586619..1587743 | - | 1125 | WP_257713170.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
NAL25_RS07700 (NAL25_07690) | 1587774..1588694 | - | 921 | WP_046896982.1 | LysR family transcriptional regulator | - |
NAL25_RS07705 (NAL25_07695) | 1588800..1589957 | + | 1158 | WP_257712827.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11644.57 Da Isoelectric Point: 4.7085
>T246574 WP_046896980.1 NZ_CP098030:1585410-1585724 [Serratia ureilytica]
MQFTVYANSGNSAIYPLLLDVTSDIIGQLNRRVVIPLLPVEKYPGSPRPERLIPLIKLIDDNEYAVMTYEMASIPVRALG
AEFCDVSQYRSRIKAAIDFLLDGI
MQFTVYANSGNSAIYPLLLDVTSDIIGQLNRRVVIPLLPVEKYPGSPRPERLIPLIKLIDDNEYAVMTYEMASIPVRALG
AEFCDVSQYRSRIKAAIDFLLDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|