Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1455059..1455626 Replicon chromosome
Accession NZ_CP098030
Organism Serratia ureilytica strain HNU47

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NAL25_RS07015 Protein ID WP_235430901.1
Coordinates 1455059..1455379 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag NAL25_RS07020 Protein ID WP_046896889.1
Coordinates 1455366..1455626 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NAL25_RS06980 (NAL25_06970) 1450709..1451785 + 1077 WP_046896883.1 urea ABC transporter permease subunit UrtC -
NAL25_RS06985 (NAL25_06975) 1451782..1452588 + 807 WP_015377102.1 urea ABC transporter ATP-binding protein UrtD -
NAL25_RS06990 (NAL25_06980) 1452601..1453299 + 699 WP_182264906.1 urea ABC transporter ATP-binding subunit UrtE -
NAL25_RS06995 (NAL25_06985) 1453307..1453564 - 258 WP_257712802.1 type II toxin-antitoxin system RelE/ParE family toxin -
NAL25_RS07000 (NAL25_06990) 1453591..1453854 - 264 WP_004939442.1 type II toxin-antitoxin system ParD family antitoxin -
NAL25_RS07005 (NAL25_06995) 1453989..1454501 + 513 WP_046896886.1 DUF2165 family protein -
NAL25_RS07010 (NAL25_07000) 1454522..1455034 - 513 WP_046896887.1 GNAT family N-acetyltransferase -
NAL25_RS07015 (NAL25_07005) 1455059..1455379 - 321 WP_235430901.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NAL25_RS07020 (NAL25_07010) 1455366..1455626 - 261 WP_046896889.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NAL25_RS07025 (NAL25_07015) 1455695..1456930 - 1236 WP_046896890.1 FAD-dependent oxidoreductase -
NAL25_RS07030 (NAL25_07020) 1457211..1458080 + 870 WP_033642340.1 LysR substrate-binding domain-containing protein -
NAL25_RS07035 (NAL25_07025) 1458077..1458922 - 846 WP_046897113.1 3-mercaptopyruvate sulfurtransferase -
NAL25_RS07040 (NAL25_07030) 1459030..1459452 + 423 WP_046896892.1 NUDIX hydrolase -
NAL25_RS07045 (NAL25_07035) 1459462..1460127 - 666 WP_046896893.1 epimerase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(10-97)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-65)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12477.33 Da        Isoelectric Point: 9.9748

>T246573 WP_235430901.1 NZ_CP098030:c1455379-1455059 [Serratia ureilytica]
MKQTEMPAFRLTPQAQQDLLAIRHFTIEHWGQAQSRRYLEQLREVMHHLADMSEAGKAHFHDLGEAIRSFPYASHRIYYR
SRPAGITVLAILHQAMVPHRHLEQRL

Download         Length: 321 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9515.71 Da        Isoelectric Point: 4.3193

>AT246573 WP_046896889.1 NZ_CP098030:c1455626-1455366 [Serratia ureilytica]
MYALSANEAKTQFGDLLLKAQREPVQINRNGKPVAVVMSVEDYQALEDLKLRALQQKIAQATAEEDAGKAVDGDAFFNRM
LTDETD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References