Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1111845..1112467 | Replicon | chromosome |
Accession | NZ_CP098030 | ||
Organism | Serratia ureilytica strain HNU47 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A8B4G7F9 |
Locus tag | NAL25_RS05290 | Protein ID | WP_004940313.1 |
Coordinates | 1111845..1112048 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
Locus tag | NAL25_RS05295 | Protein ID | WP_004940312.1 |
Coordinates | 1112099..1112467 (-) | Length | 123 a.a. |
Genomic Context
Location: 1107655..1108101 (447 bp)
Type: Others
Protein ID: WP_046897511.1
Type: Others
Protein ID: WP_046897511.1
Location: 1108135..1108950 (816 bp)
Type: Others
Protein ID: WP_257712737.1
Type: Others
Protein ID: WP_257712737.1
Location: 1109563..1110990 (1428 bp)
Type: Others
Protein ID: WP_182265013.1
Type: Others
Protein ID: WP_182265013.1
Location: 1111043..1111561 (519 bp)
Type: Others
Protein ID: WP_046897507.1
Type: Others
Protein ID: WP_046897507.1
Location: 1113381..1114094 (714 bp)
Type: Others
Protein ID: WP_046897504.1
Type: Others
Protein ID: WP_046897504.1
Location: 1114091..1114948 (858 bp)
Type: Others
Protein ID: WP_046897503.1
Type: Others
Protein ID: WP_046897503.1
Location: 1114974..1115852 (879 bp)
Type: Others
Protein ID: WP_042783804.1
Type: Others
Protein ID: WP_042783804.1
Location: 1108947..1109309 (363 bp)
Type: Others
Protein ID: WP_052759924.1
Type: Others
Protein ID: WP_052759924.1
Location: 1111845..1112048 (204 bp)
Type: Toxin
Protein ID: WP_004940313.1
Type: Toxin
Protein ID: WP_004940313.1
Location: 1112099..1112467 (369 bp)
Type: Antitoxin
Protein ID: WP_004940312.1
Type: Antitoxin
Protein ID: WP_004940312.1
Location: 1112627..1112980 (354 bp)
Type: Others
Protein ID: WP_046897506.1
Type: Others
Protein ID: WP_046897506.1
Location: 1115958..1116098 (141 bp)
Type: Others
Protein ID: WP_004940304.1
Type: Others
Protein ID: WP_004940304.1
Location: 1116111..1116365 (255 bp)
Type: Others
Protein ID: WP_004940303.1
Type: Others
Protein ID: WP_004940303.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL25_RS05265 (NAL25_05260) | 1107655..1108101 | + | 447 | WP_046897511.1 | type II secretion system protein GspM | - |
NAL25_RS05270 (NAL25_05265) | 1108135..1108950 | + | 816 | WP_257712737.1 | A24 family peptidase | - |
NAL25_RS05275 (NAL25_05270) | 1108947..1109309 | - | 363 | WP_052759924.1 | type II secretion system pilot lipoprotein GspS | - |
NAL25_RS05280 (NAL25_05275) | 1109563..1110990 | + | 1428 | WP_182265013.1 | N-acetylglucosamine-binding protein GbpA | - |
NAL25_RS05285 (NAL25_05280) | 1111043..1111561 | + | 519 | WP_046897507.1 | cytochrome b/b6 domain-containing protein | - |
NAL25_RS05290 (NAL25_05285) | 1111845..1112048 | - | 204 | WP_004940313.1 | HHA domain-containing protein | Toxin |
NAL25_RS05295 (NAL25_05290) | 1112099..1112467 | - | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
NAL25_RS05300 (NAL25_05295) | 1112627..1112980 | - | 354 | WP_046897506.1 | hypothetical protein | - |
NAL25_RS05305 (NAL25_05300) | 1113381..1114094 | + | 714 | WP_046897504.1 | ABC transporter ATP-binding protein | - |
NAL25_RS05310 (NAL25_05305) | 1114091..1114948 | + | 858 | WP_046897503.1 | metal ABC transporter permease | - |
NAL25_RS05315 (NAL25_05310) | 1114974..1115852 | + | 879 | WP_042783804.1 | zinc ABC transporter substrate-binding protein | - |
NAL25_RS05320 (NAL25_05315) | 1115958..1116098 | - | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
NAL25_RS05325 (NAL25_05320) | 1116111..1116365 | - | 255 | WP_004940303.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8107.37 Da Isoelectric Point: 6.9756
>T246572 WP_004940313.1 NZ_CP098030:c1112048-1111845 [Serratia ureilytica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT246572 WP_004940312.1 NZ_CP098030:c1112467-1112099 [Serratia ureilytica]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4G7F9 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X2G5J9 |