Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1111845..1112467 Replicon chromosome
Accession NZ_CP098030
Organism Serratia ureilytica strain HNU47

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag NAL25_RS05290 Protein ID WP_004940313.1
Coordinates 1111845..1112048 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag NAL25_RS05295 Protein ID WP_004940312.1
Coordinates 1112099..1112467 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NAL25_RS05265 (NAL25_05260) 1107655..1108101 + 447 WP_046897511.1 type II secretion system protein GspM -
NAL25_RS05270 (NAL25_05265) 1108135..1108950 + 816 WP_257712737.1 A24 family peptidase -
NAL25_RS05275 (NAL25_05270) 1108947..1109309 - 363 WP_052759924.1 type II secretion system pilot lipoprotein GspS -
NAL25_RS05280 (NAL25_05275) 1109563..1110990 + 1428 WP_182265013.1 N-acetylglucosamine-binding protein GbpA -
NAL25_RS05285 (NAL25_05280) 1111043..1111561 + 519 WP_046897507.1 cytochrome b/b6 domain-containing protein -
NAL25_RS05290 (NAL25_05285) 1111845..1112048 - 204 WP_004940313.1 HHA domain-containing protein Toxin
NAL25_RS05295 (NAL25_05290) 1112099..1112467 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
NAL25_RS05300 (NAL25_05295) 1112627..1112980 - 354 WP_046897506.1 hypothetical protein -
NAL25_RS05305 (NAL25_05300) 1113381..1114094 + 714 WP_046897504.1 ABC transporter ATP-binding protein -
NAL25_RS05310 (NAL25_05305) 1114091..1114948 + 858 WP_046897503.1 metal ABC transporter permease -
NAL25_RS05315 (NAL25_05310) 1114974..1115852 + 879 WP_042783804.1 zinc ABC transporter substrate-binding protein -
NAL25_RS05320 (NAL25_05315) 1115958..1116098 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
NAL25_RS05325 (NAL25_05320) 1116111..1116365 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T246572 WP_004940313.1 NZ_CP098030:c1112048-1111845 [Serratia ureilytica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT246572 WP_004940312.1 NZ_CP098030:c1112467-1112099 [Serratia ureilytica]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References