Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 39626..40763 | Replicon | plasmid pQZ076-3 |
Accession | NZ_CP098028 | ||
Organism | Enterococcus faecalis strain QZ076 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | NAG05_RS15625 | Protein ID | WP_250170996.1 |
Coordinates | 39626..40489 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | B3CKC7 |
Locus tag | NAG05_RS15630 | Protein ID | WP_002333002.1 |
Coordinates | 40491..40763 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG05_RS15600 (35081) | 35081..35425 | + | 345 | Protein_39 | IS30 family transposase | - |
NAG05_RS15605 (35497) | 35497..37110 | - | 1614 | WP_002333004.1 | hypothetical protein | - |
NAG05_RS15610 (37134) | 37134..38015 | - | 882 | WP_002326774.1 | ABC transporter ATP-binding protein | - |
NAG05_RS15615 (38326) | 38326..38922 | + | 597 | WP_085442989.1 | TetR/AcrR family transcriptional regulator | - |
NAG05_RS15620 (39091) | 39091..39495 | - | 405 | Protein_43 | DnaJ domain-containing protein | - |
NAG05_RS15625 (39626) | 39626..40489 | - | 864 | WP_250170996.1 | zeta toxin family protein | Toxin |
NAG05_RS15630 (40491) | 40491..40763 | - | 273 | WP_002333002.1 | antitoxin | Antitoxin |
NAG05_RS15635 (40781) | 40781..40996 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
NAG05_RS15640 (41088) | 41088..41984 | - | 897 | WP_002387620.1 | ParA family protein | - |
NAG05_RS15645 (42087) | 42087..43919 | - | 1833 | WP_250652965.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrG / aph(3')-III / erm(B) | - | 1..55867 | 55867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32365.76 Da Isoelectric Point: 6.3643
>T246566 WP_250170996.1 NZ_CP098028:c40489-39626 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|