246561

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 14827..15398 Replicon plasmid pQZ076-3
Accession NZ_CP098028
Organism Enterococcus faecalis strain QZ076

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag NAG05_RS15480 Protein ID WP_002362432.1
Coordinates 14827..15168 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag NAG05_RS15485 Protein ID WP_002362431.1
Coordinates 15168..15398 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NAG05_RS15455 (10887) 10887..11282 - 396 WP_002383639.1 hypothetical protein -
NAG05_RS15460 (11239) 11239..12561 - 1323 Protein_11 ATP-binding protein -
NAG05_RS15465 (12637) 12637..13317 + 681 WP_174087370.1 IS6-like element IS1216 family transposase -
NAG05_RS15470 (13372) 13372..13512 - 141 Protein_13 cell filamentation protein Fic -
NAG05_RS15475 (13777) 13777..14715 - 939 WP_002362433.1 hypothetical protein -
NAG05_RS15480 (14827) 14827..15168 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NAG05_RS15485 (15168) 15168..15398 - 231 WP_002362431.1 hypothetical protein Antitoxin
NAG05_RS15490 (15602) 15602..16222 + 621 WP_162500025.1 recombinase family protein -
NAG05_RS15495 (16239) 16239..16403 + 165 WP_250652966.1 hypothetical protein -
NAG05_RS15505 (17807) 17807..18040 + 234 WP_002394799.1 hypothetical protein -
NAG05_RS15510 (18200) 18200..18454 - 255 WP_002394800.1 hypothetical protein -
NAG05_RS15515 (18571) 18571..19239 - 669 WP_002403283.1 CPBP family intramembrane metalloprotease -
NAG05_RS15520 (19275) 19275..19592 - 318 WP_002394802.1 heavy metal-binding domain-containing protein -
NAG05_RS15525 (20087) 20087..20197 + 111 WP_002360667.1 type I toxin-antitoxin system Fst family toxin -
- (20237) 20237..20328 - 92 NuclAT_0 - -
- (20237) 20237..20328 - 92 NuclAT_0 - -
- (20237) 20237..20328 - 92 NuclAT_0 - -
- (20237) 20237..20328 - 92 NuclAT_0 - -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrG / aph(3')-III / erm(B) - 1..55867 55867
- flank IS/Tn - - 12631..13317 686


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T246561 WP_002362432.1 NZ_CP098028:c15168-14827 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT246561 WP_002362431.1 NZ_CP098028:c15398-15168 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References