246560

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 51828..52399 Replicon plasmid pQZ076-2
Accession NZ_CP098027
Organism Enterococcus faecalis strain QZ076

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag NAG05_RS15325 Protein ID WP_002362432.1
Coordinates 51828..52169 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag NAG05_RS15330 Protein ID WP_002362431.1
Coordinates 52169..52399 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NAG05_RS15305 (NAG05_15305) 47226..48509 - 1284 WP_242900418.1 hypothetical protein -
NAG05_RS15315 (NAG05_15315) 49911..50513 - 603 WP_250652964.1 Fic family protein -
NAG05_RS15320 (NAG05_15320) 50778..51716 - 939 WP_002362433.1 hypothetical protein -
NAG05_RS15325 (NAG05_15325) 51828..52169 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
NAG05_RS15330 (NAG05_15330) 52169..52399 - 231 WP_002362431.1 hypothetical protein Antitoxin
NAG05_RS15335 (NAG05_15335) 52603..53223 + 621 WP_002367784.1 recombinase family protein -
NAG05_RS15340 (NAG05_15340) 53213..53527 + 315 WP_002367785.1 hypothetical protein -
NAG05_RS15345 (NAG05_15345) 53521..53727 + 207 WP_002367786.1 hypothetical protein -
NAG05_RS15350 (NAG05_15350) 53887..54081 + 195 WP_002367787.1 hypothetical protein -
NAG05_RS15355 (NAG05_15355) 54093..54284 + 192 WP_002367788.1 hypothetical protein -
NAG05_RS15360 (NAG05_15360) 54454..54669 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
NAG05_RS15365 (NAG05_15365) 54670..55011 + 342 WP_002367792.1 bacteriocin immunity protein -
NAG05_RS15370 (NAG05_15370) 55427..55945 + 519 WP_002367793.1 hypothetical protein -
NAG05_RS15375 (NAG05_15375) 55893..56108 + 216 WP_002415356.1 hypothetical protein -
NAG05_RS15380 (NAG05_15380) 56200..56286 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
NAG05_RS15385 (NAG05_15385) 56543..56839 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / str - 1..59955 59955


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T246560 WP_002362432.1 NZ_CP098027:c52169-51828 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT246560 WP_002362431.1 NZ_CP098027:c52399-52169 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References