Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1912401..1913095 | Replicon | chromosome |
| Accession | NZ_CP098025 | ||
| Organism | Enterococcus faecalis strain QZ076 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | NAG05_RS09720 | Protein ID | WP_002395798.1 |
| Coordinates | 1912751..1913095 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | NAG05_RS09715 | Protein ID | WP_002364355.1 |
| Coordinates | 1912401..1912733 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG05_RS09665 (1907668) | 1907668..1907886 | - | 219 | WP_016626784.1 | hypothetical protein | - |
| NAG05_RS09670 (1907888) | 1907888..1908799 | - | 912 | WP_250652839.1 | YqaJ viral recombinase family protein | - |
| NAG05_RS09675 (1908801) | 1908801..1909061 | - | 261 | WP_231450472.1 | hypothetical protein | - |
| NAG05_RS09680 (1909065) | 1909065..1910261 | - | 1197 | WP_250652956.1 | DEAD/DEAH box helicase | - |
| NAG05_RS09685 (1910251) | 1910251..1910544 | - | 294 | WP_002407629.1 | recombinase RecB | - |
| NAG05_RS09690 (1910541) | 1910541..1910741 | - | 201 | WP_202577733.1 | hypothetical protein | - |
| NAG05_RS09700 (1910953) | 1910953..1911348 | - | 396 | WP_231450469.1 | hypothetical protein | - |
| NAG05_RS09705 (1911591) | 1911591..1911902 | - | 312 | WP_250652840.1 | hypothetical protein | - |
| NAG05_RS09710 (1911913) | 1911913..1912089 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| NAG05_RS09715 (1912401) | 1912401..1912733 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NAG05_RS09720 (1912751) | 1912751..1913095 | + | 345 | WP_002395798.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| NAG05_RS09725 (1913129) | 1913129..1913857 | + | 729 | WP_126262607.1 | potassium channel family protein | - |
| NAG05_RS09730 (1913954) | 1913954..1915102 | + | 1149 | WP_126262606.1 | site-specific integrase | - |
| NAG05_RS09735 (1915130) | 1915130..1915573 | - | 444 | WP_125203765.1 | competence type IV pilus minor pilin ComGD | - |
| NAG05_RS09740 (1915570) | 1915570..1915845 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| NAG05_RS09745 (1915845) | 1915845..1916891 | - | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| NAG05_RS09750 (1916848) | 1916848..1917816 | - | 969 | WP_002374519.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1869799..1915546 | 45747 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13718.69 Da Isoelectric Point: 6.1363
>T246546 WP_002395798.1 NZ_CP098025:1912751-1913095 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLK
MKSIKELVEEYEVELVFAPINKRACYEPVKRIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHDGQFNYSNVITHYNLKMGQETYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|