Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1475471..1476105 | Replicon | chromosome |
Accession | NZ_CP097984 | ||
Organism | Pimelobacter simplex strain N39 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M0M43_RS07175 | Protein ID | WP_257753291.1 |
Coordinates | 1475695..1476105 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M0M43_RS07170 | Protein ID | WP_215813961.1 |
Coordinates | 1475471..1475698 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M0M43_RS07150 (M0M43_07150) | 1471086..1471619 | + | 534 | WP_215813965.1 | DNA starvation/stationary phase protection protein | - |
M0M43_RS07155 (M0M43_07155) | 1471663..1472871 | + | 1209 | WP_257753288.1 | cytochrome P450 | - |
M0M43_RS07160 (M0M43_07160) | 1472873..1473403 | + | 531 | WP_257753289.1 | TetR family transcriptional regulator | - |
M0M43_RS07165 (M0M43_07165) | 1473467..1475434 | + | 1968 | WP_257753290.1 | AarF/UbiB family protein | - |
M0M43_RS07170 (M0M43_07170) | 1475471..1475698 | + | 228 | WP_215813961.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
M0M43_RS07175 (M0M43_07175) | 1475695..1476105 | + | 411 | WP_257753291.1 | PIN domain nuclease | Toxin |
M0M43_RS07180 (M0M43_07180) | 1476095..1478446 | - | 2352 | WP_257753292.1 | arylsulfatase | - |
M0M43_RS07185 (M0M43_07185) | 1478458..1479417 | - | 960 | WP_257753293.1 | formylglycine-generating enzyme family protein | - |
M0M43_RS07190 (M0M43_07190) | 1479414..1481084 | - | 1671 | WP_257753294.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15060.29 Da Isoelectric Point: 5.6749
>T246541 WP_257753291.1 NZ_CP097984:1475695-1476105 [Pimelobacter simplex]
MTDWLIDKSALVRLAHAAERDEWRERCRRGLVRITSPTLLEAGFSARSADDWQALVAGPPVSWFPVEYLTPAIERRALDV
QRILAARGQHRAPSVPDLLIAATAELAGLVVLHLDKDFELIADVTGQQVERLGLTA
MTDWLIDKSALVRLAHAAERDEWRERCRRGLVRITSPTLLEAGFSARSADDWQALVAGPPVSWFPVEYLTPAIERRALDV
QRILAARGQHRAPSVPDLLIAATAELAGLVVLHLDKDFELIADVTGQQVERLGLTA
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|