Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2605779..2606369 | Replicon | chromosome |
| Accession | NZ_CP097983 | ||
| Organism | Pantoea alhagi strain NX-11 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | LQ939_RS12155 | Protein ID | WP_250650246.1 |
| Coordinates | 2605779..2606111 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | LQ939_RS12160 | Protein ID | WP_250650247.1 |
| Coordinates | 2606112..2606369 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ939_RS12135 (LQ939_12120) | 2601747..2602604 | - | 858 | WP_250650244.1 | SDR family oxidoreductase | - |
| LQ939_RS12140 (LQ939_12125) | 2602913..2603410 | + | 498 | WP_085071259.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LQ939_RS12145 (LQ939_12130) | 2603542..2604990 | - | 1449 | WP_250650245.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| LQ939_RS12155 (LQ939_12140) | 2605779..2606111 | - | 333 | WP_250650246.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LQ939_RS12160 (LQ939_12145) | 2606112..2606369 | - | 258 | WP_250650247.1 | antitoxin | Antitoxin |
| LQ939_RS12165 (LQ939_12150) | 2606717..2606923 | - | 207 | WP_029570199.1 | cell morphology transcriptional regulator XreR2 | - |
| LQ939_RS12170 (LQ939_12155) | 2606920..2607381 | - | 462 | WP_250650248.1 | hypothetical protein | - |
| LQ939_RS12175 (LQ939_12160) | 2607364..2607621 | - | 258 | Protein_2379 | ash family protein | - |
| LQ939_RS12180 (LQ939_12165) | 2607779..2609041 | + | 1263 | WP_250650249.1 | hypothetical protein | - |
| LQ939_RS12185 (LQ939_12170) | 2609187..2609600 | + | 414 | WP_250650250.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11903.92 Da Isoelectric Point: 10.5834
>T246540 WP_250650246.1 NZ_CP097983:c2606111-2605779 [Pantoea alhagi]
MDRGEIWLVSLDPIADHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLAGAGIKTTGVIRCDQPRTI
DMVARNGKRLERIPESILNEVLARLEAILI
MDRGEIWLVSLDPIADHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLAGAGIKTTGVIRCDQPRTI
DMVARNGKRLERIPESILNEVLARLEAILI
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|