Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1248118..1248744 | Replicon | chromosome |
| Accession | NZ_CP097983 | ||
| Organism | Pantoea alhagi strain NX-11 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A2K1QC31 |
| Locus tag | LQ939_RS05690 | Protein ID | WP_071883698.1 |
| Coordinates | 1248118..1248336 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LQ939_RS05695 | Protein ID | WP_085067696.1 |
| Coordinates | 1248364..1248744 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ939_RS05660 (LQ939_05650) | 1244089..1244427 | + | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
| LQ939_RS05665 (LQ939_05655) | 1244463..1245747 | + | 1285 | Protein_1112 | ammonium transporter AmtB | - |
| LQ939_RS05670 (LQ939_05660) | 1245802..1246662 | - | 861 | WP_250652062.1 | acyl-CoA thioesterase II | - |
| LQ939_RS05675 (LQ939_05665) | 1246878..1247432 | + | 555 | WP_250652063.1 | YbaY family lipoprotein | - |
| LQ939_RS05680 (LQ939_05670) | 1247463..1247771 | - | 309 | WP_085067697.1 | MGMT family protein | - |
| LQ939_RS05690 (LQ939_05680) | 1248118..1248336 | - | 219 | WP_071883698.1 | HHA domain-containing protein | Toxin |
| LQ939_RS05695 (LQ939_05685) | 1248364..1248744 | - | 381 | WP_085067696.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ939_RS05700 (LQ939_05690) | 1248893..1249237 | - | 345 | WP_085067695.1 | hypothetical protein | - |
| LQ939_RS05705 (LQ939_05695) | 1249590..1249730 | - | 141 | WP_085067694.1 | type B 50S ribosomal protein L36 | - |
| LQ939_RS05710 (LQ939_05700) | 1249746..1250003 | - | 258 | WP_085067693.1 | type B 50S ribosomal protein L31 | - |
| LQ939_RS05715 (LQ939_05705) | 1250187..1253336 | - | 3150 | WP_250652064.1 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8701.16 Da Isoelectric Point: 8.8578
>T246534 WP_071883698.1 NZ_CP097983:c1248336-1248118 [Pantoea alhagi]
MTEKIMTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPVSVWKYVR
MTEKIMTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPVSVWKYVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14727.33 Da Isoelectric Point: 4.2930
>AT246534 WP_085067696.1 NZ_CP097983:c1248744-1248364 [Pantoea alhagi]
MDEYSPKRHDIAQLNFLCENLYDESMATLGDSHHGWVNDPTSASNLQLNDLIEHIASFTMNYKIKHAEDEDLIVQIDDYL
DDTFMLFSNYGINVQDLQRWQRSARRLFNLFAEECAQLPLQPSHSF
MDEYSPKRHDIAQLNFLCENLYDESMATLGDSHHGWVNDPTSASNLQLNDLIEHIASFTMNYKIKHAEDEDLIVQIDDYL
DDTFMLFSNYGINVQDLQRWQRSARRLFNLFAEECAQLPLQPSHSF
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|