Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 593971..594674 Replicon chromosome
Accession NZ_CP097983
Organism Pantoea alhagi strain NX-11

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag LQ939_RS02785 Protein ID WP_171402893.1
Coordinates 594333..594674 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag LQ939_RS02780 Protein ID WP_250651659.1
Coordinates 593971..594297 (+) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ939_RS02750 (LQ939_02750) 589434..590310 + 877 Protein_538 GTPase family protein -
LQ939_RS02755 (LQ939_02755) 590523..591224 + 702 WP_250651656.1 WYL domain-containing protein -
LQ939_RS02760 (LQ939_02760) 591230..591862 + 633 WP_250651657.1 hypothetical protein -
LQ939_RS02765 (LQ939_02765) 592031..592441 + 411 WP_250652656.1 IrmA family protein -
LQ939_RS02770 (LQ939_02770) 592561..593382 + 822 WP_250651658.1 DUF932 domain-containing protein -
LQ939_RS02775 (LQ939_02775) 593453..593926 + 474 WP_171402892.1 DNA repair protein RadC -
LQ939_RS02780 (LQ939_02780) 593971..594297 + 327 WP_250651659.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ939_RS02785 (LQ939_02785) 594333..594674 + 342 WP_171402893.1 TA system toxin CbtA family protein Toxin
LQ939_RS02790 (LQ939_02790) 594789..595622 + 834 WP_250651660.1 DUF4942 domain-containing protein -
LQ939_RS02795 (LQ939_02795) 595699..595947 + 249 WP_000535213.1 ribbon-helix-helix domain-containing protein -
LQ939_RS02800 (LQ939_02800) 595951..596226 + 276 WP_250651661.1 type II toxin-antitoxin system RelE/ParE family toxin -
LQ939_RS02805 (LQ939_02805) 596342..597140 + 799 Protein_549 helix-turn-helix transcriptional regulator -
LQ939_RS02810 (LQ939_02810) 597564..598388 + 825 WP_250651662.1 hypothetical protein -
LQ939_RS02815 (LQ939_02815) 598396..598695 + 300 WP_250651663.1 contact-dependent growth inhibition system immunity protein -
LQ939_RS02820 (LQ939_02820) 598855..599292 - 438 Protein_552 integrase core domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 576639..614610 37971
- flank IS/Tn - - 598855..599166 311


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(8-107)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12916.83 Da        Isoelectric Point: 8.5195

>T246531 WP_171402893.1 NZ_CP097983:594333-594674 [Pantoea alhagi]
MKTLPASTQRAAKPCPTPVVVWQTLLTRLLEQHYGLTLNDTPFCDETVIQEHINAGITLADAVNFLVEKYELIRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSHNLSTR

Download         Length: 342 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 12320.00 Da        Isoelectric Point: 6.0691

>AT246531 WP_250651659.1 NZ_CP097983:593971-594297 [Pantoea alhagi]
MEKNDPIEWGLRRDITPRVGARLVQEGNQLHYLVGRAGVTGIFNEAESRKLNAAFPHFVEQMELMLLSGELNPRYAHCVT
LYHDGFTCEADTLGSYGYVYIVIYPTQR

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References