Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 593971..594674 | Replicon | chromosome |
| Accession | NZ_CP097983 | ||
| Organism | Pantoea alhagi strain NX-11 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | LQ939_RS02785 | Protein ID | WP_171402893.1 |
| Coordinates | 594333..594674 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | LQ939_RS02780 | Protein ID | WP_250651659.1 |
| Coordinates | 593971..594297 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ939_RS02750 (LQ939_02750) | 589434..590310 | + | 877 | Protein_538 | GTPase family protein | - |
| LQ939_RS02755 (LQ939_02755) | 590523..591224 | + | 702 | WP_250651656.1 | WYL domain-containing protein | - |
| LQ939_RS02760 (LQ939_02760) | 591230..591862 | + | 633 | WP_250651657.1 | hypothetical protein | - |
| LQ939_RS02765 (LQ939_02765) | 592031..592441 | + | 411 | WP_250652656.1 | IrmA family protein | - |
| LQ939_RS02770 (LQ939_02770) | 592561..593382 | + | 822 | WP_250651658.1 | DUF932 domain-containing protein | - |
| LQ939_RS02775 (LQ939_02775) | 593453..593926 | + | 474 | WP_171402892.1 | DNA repair protein RadC | - |
| LQ939_RS02780 (LQ939_02780) | 593971..594297 | + | 327 | WP_250651659.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ939_RS02785 (LQ939_02785) | 594333..594674 | + | 342 | WP_171402893.1 | TA system toxin CbtA family protein | Toxin |
| LQ939_RS02790 (LQ939_02790) | 594789..595622 | + | 834 | WP_250651660.1 | DUF4942 domain-containing protein | - |
| LQ939_RS02795 (LQ939_02795) | 595699..595947 | + | 249 | WP_000535213.1 | ribbon-helix-helix domain-containing protein | - |
| LQ939_RS02800 (LQ939_02800) | 595951..596226 | + | 276 | WP_250651661.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LQ939_RS02805 (LQ939_02805) | 596342..597140 | + | 799 | Protein_549 | helix-turn-helix transcriptional regulator | - |
| LQ939_RS02810 (LQ939_02810) | 597564..598388 | + | 825 | WP_250651662.1 | hypothetical protein | - |
| LQ939_RS02815 (LQ939_02815) | 598396..598695 | + | 300 | WP_250651663.1 | contact-dependent growth inhibition system immunity protein | - |
| LQ939_RS02820 (LQ939_02820) | 598855..599292 | - | 438 | Protein_552 | integrase core domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 576639..614610 | 37971 | |
| - | flank | IS/Tn | - | - | 598855..599166 | 311 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12916.83 Da Isoelectric Point: 8.5195
>T246531 WP_171402893.1 NZ_CP097983:594333-594674 [Pantoea alhagi]
MKTLPASTQRAAKPCPTPVVVWQTLLTRLLEQHYGLTLNDTPFCDETVIQEHINAGITLADAVNFLVEKYELIRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSHNLSTR
MKTLPASTQRAAKPCPTPVVVWQTLLTRLLEQHYGLTLNDTPFCDETVIQEHINAGITLADAVNFLVEKYELIRIDRRGF
SWQEQSPYLRAVDILRARQATGLLRQSHNLSTR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|