Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
Location | 2964471..2965144 | Replicon | chromosome |
Accession | NZ_CP097897 | ||
Organism | Acetobacterium wieringae strain CH1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | CHL1_RS14530 | Protein ID | WP_250933628.1 |
Coordinates | 2964779..2965144 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | CHL1_RS14525 | Protein ID | WP_250933626.1 |
Coordinates | 2964471..2964782 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CHL1_RS14515 (CHL1_002901) | 2963009..2963635 | - | 627 | WP_250933622.1 | hypothetical protein | - |
CHL1_RS14520 (CHL1_002902) | 2963902..2964327 | + | 426 | WP_250933623.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
CHL1_RS14525 (CHL1_002903) | 2964471..2964782 | - | 312 | WP_250933626.1 | helix-turn-helix transcriptional regulator | Antitoxin |
CHL1_RS14530 (CHL1_002904) | 2964779..2965144 | - | 366 | WP_250933628.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CHL1_RS14535 (CHL1_002905) | 2965284..2966555 | - | 1272 | WP_250933629.1 | nickel-dependent lactate racemase | - |
CHL1_RS14540 (CHL1_002906) | 2966791..2968329 | - | 1539 | WP_250933631.1 | L-lactate permease | - |
CHL1_RS14545 (CHL1_002907) | 2968338..2969738 | - | 1401 | WP_250933633.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14601.78 Da Isoelectric Point: 9.9994
>T246530 WP_250933628.1 NZ_CP097897:c2965144-2964779 [Acetobacterium wieringae]
MYEVIFYKDAKGNEPIREYLTSLKTKASSSKQNRVKFIKITSYIRSLQEYGTRIGNPTVKHIDGDIWELRPLSDRIFFFY
WQDDTFVLLHYFHKKSQKIPRKEIEKAINNMNDFKERVCQQ
MYEVIFYKDAKGNEPIREYLTSLKTKASSSKQNRVKFIKITSYIRSLQEYGTRIGNPTVKHIDGDIWELRPLSDRIFFFY
WQDDTFVLLHYFHKKSQKIPRKEIEKAINNMNDFKERVCQQ
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|