Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 1882734..1883281 Replicon chromosome
Accession NZ_CP097897
Organism Acetobacterium wieringae strain CH1

Toxin (Protein)


Gene name relE Uniprot ID A0A1F2PDS3
Locus tag CHL1_RS09230 Protein ID WP_070372270.1
Coordinates 1883006..1883281 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1F2PDT0
Locus tag CHL1_RS09225 Protein ID WP_070372269.1
Coordinates 1882734..1883009 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CHL1_RS09200 (CHL1_001840) 1878431..1879381 - 951 WP_187389199.1 methyl-accepting chemotaxis protein -
CHL1_RS09205 (CHL1_001841) 1879398..1880498 - 1101 WP_250932473.1 FIST N-terminal domain-containing protein -
CHL1_RS09210 (CHL1_001842) 1880844..1881722 - 879 WP_250932475.1 AraC family transcriptional regulator -
CHL1_RS09215 (CHL1_001843) 1881896..1882201 - 306 WP_250932477.1 hypothetical protein -
CHL1_RS09220 (CHL1_001844) 1882265..1882522 - 258 WP_250932479.1 hypothetical protein -
CHL1_RS09225 (CHL1_001845) 1882734..1883009 + 276 WP_070372269.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
CHL1_RS09230 (CHL1_001846) 1883006..1883281 + 276 WP_070372270.1 type II toxin-antitoxin system YafQ family toxin Toxin
CHL1_RS09235 (CHL1_001847) 1883567..1883920 + 354 Protein_1790 HNH endonuclease signature motif containing protein -
CHL1_RS09240 (CHL1_001848) 1883925..1884239 - 315 WP_148637100.1 type II toxin-antitoxin system RelE/ParE family toxin -
CHL1_RS09245 (CHL1_001849) 1884226..1884498 - 273 WP_070372273.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
CHL1_RS09250 (CHL1_001850) 1884561..1885084 + 524 Protein_1793 ParB N-terminal domain-containing protein -
CHL1_RS09255 (CHL1_001851) 1885425..1885880 + 456 WP_250932481.1 hypothetical protein -
CHL1_RS09260 (CHL1_001852) 1885843..1887414 + 1572 WP_250932482.1 recombinase family protein -
CHL1_RS09265 (CHL1_001853) 1887469..1888113 - 645 WP_250932484.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-73)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10856.51 Da        Isoelectric Point: 6.2245

>T246529 WP_070372270.1 NZ_CP097897:1883006-1883281 [Acetobacterium wieringae]
MKYEVKFTNQFKKDLKLAKKQGRDIDRLYAVIEKLADDEPLEQKYRDHDLSGNYKGCRECHVEPDWLLVYEVMDDVLVLM
LYRIGSHSTLF

Download         Length: 276 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10059.47 Da        Isoelectric Point: 4.8279

>AT246529 WP_070372269.1 NZ_CP097897:1882734-1883009 [Acetobacterium wieringae]
MATSTNLNIRTDKDIKEAAEKIFGELGLNMTTAINIFLRQAIRENGIPFEMKLSVPNQETVAAITEGRKLAKDSSVKGYS
NMDDLRAALEE

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1F2PDS3

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2PDT0

References