Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 3646192..3646745 | Replicon | chromosome |
Accession | NZ_CP097896 | ||
Organism | Pectobacterium actinidiae strain GX-Pa1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A1V2R684 |
Locus tag | M9782_RS16005 | Protein ID | WP_039360030.1 |
Coordinates | 3646192..3646506 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A1V2R6A1 |
Locus tag | M9782_RS16010 | Protein ID | WP_039360032.1 |
Coordinates | 3646509..3646745 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9782_RS15985 (M9782_15990) | 3641502..3642518 | + | 1017 | WP_275070822.1 | P-type DNA transfer ATPase VirB11 | - |
M9782_RS15990 (M9782_15995) | 3642562..3642864 | + | 303 | WP_275070823.1 | conjugal transfer protein | - |
M9782_RS15995 (M9782_16000) | 3643661..3645397 | + | 1737 | WP_275070824.1 | type IV secretory system conjugative DNA transfer family protein | - |
M9782_RS16000 (M9782_16005) | 3645406..3646158 | + | 753 | WP_275070825.1 | MobC family replication-relaxation protein | - |
M9782_RS16005 (M9782_16010) | 3646192..3646506 | - | 315 | WP_039360030.1 | CcdB family protein | Toxin |
M9782_RS16010 (M9782_16015) | 3646509..3646745 | - | 237 | WP_039360032.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
M9782_RS16015 (M9782_16020) | 3647073..3647990 | - | 918 | WP_275070826.1 | zincin-like metallopeptidase domain-containing protein | - |
M9782_RS16020 (M9782_16025) | 3648602..3648829 | - | 228 | WP_039360037.1 | hypothetical protein | - |
M9782_RS16025 (M9782_16030) | 3649155..3649373 | - | 219 | WP_151242679.1 | cold shock domain-containing protein | - |
M9782_RS16030 (M9782_16035) | 3649656..3649868 | + | 213 | WP_151242680.1 | cold shock-like protein CspF | - |
M9782_RS16035 (M9782_16040) | 3649950..3650108 | + | 159 | WP_222431663.1 | YnfU family zinc-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 3619532..3664562 | 45030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11535.48 Da Isoelectric Point: 7.9859
>T246527 WP_039360030.1 NZ_CP097896:c3646506-3646192 [Pectobacterium actinidiae]
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGF
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V2R684 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V2R6A1 |