Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 2398831..2399741 | Replicon | chromosome |
| Accession | NZ_CP097896 | ||
| Organism | Pectobacterium actinidiae strain GX-Pa1 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M9782_RS10245 | Protein ID | WP_275072310.1 |
| Coordinates | 2399271..2399741 (+) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A1V2R4X7 |
| Locus tag | M9782_RS10240 | Protein ID | WP_039357407.1 |
| Coordinates | 2398831..2399274 (+) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9782_RS10220 (M9782_10220) | 2394226..2395257 | + | 1032 | WP_275072307.1 | iron ABC transporter permease | - |
| M9782_RS10225 (M9782_10225) | 2395270..2396121 | + | 852 | WP_275072308.1 | ABC transporter ATP-binding protein | - |
| M9782_RS10230 (M9782_10230) | 2396111..2396920 | + | 810 | WP_039506867.1 | IucA/IucC family C-terminal-domain containing protein | - |
| M9782_RS10235 (M9782_10235) | 2397218..2398654 | + | 1437 | WP_275072309.1 | ATP-dependent RNA helicase RhlE | - |
| M9782_RS10240 (M9782_10240) | 2398831..2399274 | + | 444 | WP_039357407.1 | DUF2384 domain-containing protein | Antitoxin |
| M9782_RS10245 (M9782_10245) | 2399271..2399741 | + | 471 | WP_275072310.1 | RES family NAD+ phosphorylase | Toxin |
| M9782_RS10250 (M9782_10250) | 2399842..2401071 | - | 1230 | WP_275072311.1 | peptidase T | - |
| M9782_RS10255 (M9782_10255) | 2401212..2402807 | + | 1596 | WP_275072312.1 | ABC transporter substrate-binding protein | - |
| M9782_RS10260 (M9782_10260) | 2402858..2403529 | - | 672 | WP_275072313.1 | epoxyqueuosine reductase QueH | - |
| M9782_RS10265 (M9782_10265) | 2403743..2404675 | + | 933 | WP_039357417.1 | tRNA dihydrouridine(16) synthase DusC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17804.24 Da Isoelectric Point: 4.6251
>T246526 WP_275072310.1 NZ_CP097896:2399271-2399741 [Pectobacterium actinidiae]
MILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGTSMVYVSETASLTMLETLVHLHAAQILDYYTLMRIDVPEDQIQSANMD
ELPDNWAAEEAPPDLAVYGDAWIFTQSSIALRVPSALSPVEYNYLLNPEHPDFYGIIQRVEVIPFQFDRRLKPERK
MILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGTSMVYVSETASLTMLETLVHLHAAQILDYYTLMRIDVPEDQIQSANMD
ELPDNWAAEEAPPDLAVYGDAWIFTQSSIALRVPSALSPVEYNYLLNPEHPDFYGIIQRVEVIPFQFDRRLKPERK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16449.80 Da Isoelectric Point: 9.6203
>AT246526 WP_039357407.1 NZ_CP097896:2398831-2399274 [Pectobacterium actinidiae]
MKTFSLSTTQTRPPRLWQVAGLHHSDGVALLGQIREGLEGNVANLIADWAKITQSDLRKMSGIPSTTFSRSVKARFNADQ
SERLVRIIRVIDRAVELFEGDKDDAQKWLNEPNRALGGKIPTELMVSETGAYEVMKLLTRLEHGVYS
MKTFSLSTTQTRPPRLWQVAGLHHSDGVALLGQIREGLEGNVANLIADWAKITQSDLRKMSGIPSTTFSRSVKARFNADQ
SERLVRIIRVIDRAVELFEGDKDDAQKWLNEPNRALGGKIPTELMVSETGAYEVMKLLTRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|