Detailed information of TA system
Overview
TA module
| Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
| Location | 2072437..2073236 | Replicon | chromosome |
| Accession | NZ_CP097896 | ||
| Organism | Pectobacterium actinidiae strain GX-Pa1 | ||
Toxin (Protein)
| Gene name | hepT | Uniprot ID | - |
| Locus tag | M9782_RS09065 | Protein ID | WP_275072171.1 |
| Coordinates | 2072437..2072856 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | mntA | Uniprot ID | A0A094SX92 |
| Locus tag | M9782_RS09070 | Protein ID | WP_039473810.1 |
| Coordinates | 2072853..2073236 (-) | Length | 128 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9782_RS09045 (M9782_09045) | 2067549..2068190 | + | 642 | WP_010281304.1 | uridine kinase | - |
| M9782_RS09050 (M9782_09050) | 2068298..2068879 | + | 582 | WP_005974037.1 | dCTP deaminase | - |
| M9782_RS09055 (M9782_09055) | 2068942..2070777 | + | 1836 | WP_275072169.1 | outer membrane assembly protein AsmA | - |
| M9782_RS09060 (M9782_09060) | 2071041..2072393 | + | 1353 | WP_275072170.1 | anaerobic C4-dicarboxylate transporter DcuC | - |
| M9782_RS09065 (M9782_09065) | 2072437..2072856 | - | 420 | WP_275072171.1 | DUF86 domain-containing protein | Toxin |
| M9782_RS09070 (M9782_09070) | 2072853..2073236 | - | 384 | WP_039473810.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
| M9782_RS09075 (M9782_09075) | 2073350..2074936 | - | 1587 | WP_275072172.1 | TerC family protein | - |
| M9782_RS09080 (M9782_09080) | 2075669..2076766 | + | 1098 | WP_275072173.1 | UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase | - |
| M9782_RS09085 (M9782_09085) | 2076884..2078020 | + | 1137 | WP_039356693.1 | polysaccharide export protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16078.45 Da Isoelectric Point: 6.9682
>T246525 WP_275072171.1 NZ_CP097896:c2072856-2072437 [Pectobacterium actinidiae]
MIDILLNKSTTIQRCLRRIREEFDTEEGFRQNFTKQDSVILNIQRACEAAIDIANYLIRIKQLGIPQSSRDSFALLAANQ
IITIDLSDNLQKMVGLRNIAVHDYQALNLDIVIHVISHRLSDFEHFIKQIARYSDSQHL
MIDILLNKSTTIQRCLRRIREEFDTEEGFRQNFTKQDSVILNIQRACEAAIDIANYLIRIKQLGIPQSSRDSFALLAANQ
IITIDLSDNLQKMVGLRNIAVHDYQALNLDIVIHVISHRLSDFEHFIKQIARYSDSQHL
Download Length: 420 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 14372.57 Da Isoelectric Point: 4.7463
>AT246525 WP_039473810.1 NZ_CP097896:c2073236-2072853 [Pectobacterium actinidiae]
MFDKIVLTLKKQMPDIKIIYLFGSQATGNARADSDIDIAIMATRALDPVERWELSNQLAKEVGHDVDLIDLLQASTVLKM
EIVRNGKLLYDAETAAGEFEMTTLSMYQHLQKERADIIRSFNQDLKA
MFDKIVLTLKKQMPDIKIIYLFGSQATGNARADSDIDIAIMATRALDPVERWELSNQLAKEVGHDVDLIDLLQASTVLKM
EIVRNGKLLYDAETAAGEFEMTTLSMYQHLQKERADIIRSFNQDLKA
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|