Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1815535..1816161 | Replicon | chromosome |
Accession | NZ_CP097896 | ||
Organism | Pectobacterium actinidiae strain GX-Pa1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | C6DB72 |
Locus tag | M9782_RS07905 | Protein ID | WP_005976087.1 |
Coordinates | 1815535..1815738 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | C6DB73 |
Locus tag | M9782_RS07910 | Protein ID | WP_005976089.1 |
Coordinates | 1815793..1816161 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9782_RS07875 (M9782_07875) | 1810995..1811333 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
M9782_RS07880 (M9782_07880) | 1811373..1812659 | + | 1287 | WP_039356190.1 | ammonium transporter AmtB | - |
M9782_RS07885 (M9782_07885) | 1812795..1813658 | - | 864 | WP_039356193.1 | acyl-CoA thioesterase II | - |
M9782_RS07890 (M9782_07890) | 1813872..1814453 | + | 582 | WP_039356196.1 | YbaY family lipoprotein | - |
M9782_RS07895 (M9782_07895) | 1814473..1814793 | - | 321 | WP_039356201.1 | MGMT family protein | - |
M9782_RS07905 (M9782_07905) | 1815535..1815738 | - | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
M9782_RS07910 (M9782_07910) | 1815793..1816161 | - | 369 | WP_005976089.1 | Hha toxicity modulator TomB | Antitoxin |
M9782_RS07915 (M9782_07915) | 1816758..1816901 | - | 144 | WP_005976091.1 | type B 50S ribosomal protein L36 | - |
M9782_RS07920 (M9782_07920) | 1816919..1817167 | - | 249 | WP_039356204.1 | type B 50S ribosomal protein L31 | - |
M9782_RS07925 (M9782_07925) | 1817396..1820524 | - | 3129 | WP_039356206.1 | efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T246524 WP_005976087.1 NZ_CP097896:c1815738-1815535 [Pectobacterium actinidiae]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14032.77 Da Isoelectric Point: 4.4787
>AT246524 WP_005976089.1 NZ_CP097896:c1816161-1815793 [Pectobacterium actinidiae]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7Z3F0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7Z3G5 |