Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 1586235..1586761 | Replicon | chromosome |
| Accession | NZ_CP097896 | ||
| Organism | Pectobacterium actinidiae strain GX-Pa1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | M9782_RS06965 | Protein ID | WP_275071993.1 |
| Coordinates | 1586235..1586540 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | M9782_RS06970 | Protein ID | WP_275071994.1 |
| Coordinates | 1586543..1586761 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9782_RS06935 (M9782_06935) | 1581267..1581560 | + | 294 | WP_275071987.1 | DUF1778 domain-containing protein | - |
| M9782_RS06940 (M9782_06940) | 1581557..1582051 | + | 495 | WP_275071988.1 | GNAT family N-acetyltransferase | - |
| M9782_RS06945 (M9782_06945) | 1582207..1582755 | + | 549 | WP_275071989.1 | 3'-5' exonuclease | - |
| M9782_RS06950 (M9782_06950) | 1582864..1583964 | - | 1101 | WP_275071990.1 | SAVED domain-containing protein | - |
| M9782_RS06955 (M9782_06955) | 1584004..1584531 | - | 528 | WP_275071991.1 | hypothetical protein | - |
| M9782_RS06960 (M9782_06960) | 1584538..1585818 | - | 1281 | WP_275071992.1 | nucleotidyltransferase | - |
| M9782_RS06965 (M9782_06965) | 1586235..1586540 | - | 306 | WP_275071993.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M9782_RS06970 (M9782_06970) | 1586543..1586761 | - | 219 | WP_275071994.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M9782_RS06975 (M9782_06975) | 1586820..1587563 | - | 744 | WP_275071995.1 | MobC family replication-relaxation protein | - |
| M9782_RS06980 (M9782_06980) | 1588475..1588816 | - | 342 | WP_275071996.1 | hypothetical protein | - |
| M9782_RS06985 (M9782_06985) | 1588957..1589127 | + | 171 | WP_275071997.1 | hypothetical protein | - |
| M9782_RS06990 (M9782_06990) | 1589269..1590528 | - | 1260 | WP_275071998.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1580246..1590528 | 10282 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11747.62 Da Isoelectric Point: 4.8500
>T246523 WP_275071993.1 NZ_CP097896:c1586540-1586235 [Pectobacterium actinidiae]
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPLIESHHLSEKVNKTLFPLIRVDGEDYRLMTTELSSVPVEVIGEVI
ADLGDYADEIKDAINLMFWGI
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMVIPLIESHHLSEKVNKTLFPLIRVDGEDYRLMTTELSSVPVEVIGEVI
ADLGDYADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|