Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1581267..1582051 | Replicon | chromosome |
Accession | NZ_CP097896 | ||
Organism | Pectobacterium actinidiae strain GX-Pa1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | M9782_RS06940 | Protein ID | WP_275071988.1 |
Coordinates | 1581557..1582051 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | M9782_RS06935 | Protein ID | WP_275071987.1 |
Coordinates | 1581267..1581560 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9782_RS06915 (M9782_06915) | 1576471..1578033 | - | 1563 | WP_275071986.1 | class I adenylate-forming enzyme family protein | - |
M9782_RS06920 (M9782_06920) | 1578293..1579261 | + | 969 | WP_039355779.1 | LysR family transcriptional regulator | - |
M9782_RS06925 (M9782_06925) | 1579527..1579811 | + | 285 | Protein_1343 | DNA helicase | - |
M9782_RS06930 (M9782_06930) | 1579884..1580995 | + | 1112 | WP_130621652.1 | IS3 family transposase | - |
M9782_RS06935 (M9782_06935) | 1581267..1581560 | + | 294 | WP_275071987.1 | DUF1778 domain-containing protein | Antitoxin |
M9782_RS06940 (M9782_06940) | 1581557..1582051 | + | 495 | WP_275071988.1 | GNAT family N-acetyltransferase | Toxin |
M9782_RS06945 (M9782_06945) | 1582207..1582755 | + | 549 | WP_275071989.1 | 3'-5' exonuclease | - |
M9782_RS06950 (M9782_06950) | 1582864..1583964 | - | 1101 | WP_275071990.1 | SAVED domain-containing protein | - |
M9782_RS06955 (M9782_06955) | 1584004..1584531 | - | 528 | WP_275071991.1 | hypothetical protein | - |
M9782_RS06960 (M9782_06960) | 1584538..1585818 | - | 1281 | WP_275071992.1 | nucleotidyltransferase | - |
M9782_RS06965 (M9782_06965) | 1586235..1586540 | - | 306 | WP_275071993.1 | type II toxin-antitoxin system toxin CcdB | - |
M9782_RS06970 (M9782_06970) | 1586543..1586761 | - | 219 | WP_275071994.1 | type II toxin-antitoxin system antitoxin CcdA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1580246..1590528 | 10282 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17594.51 Da Isoelectric Point: 7.8046
>T246522 WP_275071988.1 NZ_CP097896:1581557-1582051 [Pectobacterium actinidiae]
MISAPEPLHAEHVLSSFCCGVESMDNWLKLRAMKNQVTGASRTFVSCDGAKVLAYYSLASSAVATNAAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMMLMVTLGDLVG
SLSI
MISAPEPLHAEHVLSSFCCGVESMDNWLKLRAMKNQVTGASRTFVSCDGAKVLAYYSLASSAVATNAAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMMLMVTLGDLVG
SLSI
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|