Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1400980..1401358 Replicon chromosome
Accession NZ_CP097896
Organism Pectobacterium actinidiae strain GX-Pa1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag M9782_RS06190 Protein ID WP_275071911.1
Coordinates 1400980..1401117 (-) Length 46 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9782_RS06195 Protein ID WP_275071912.1
Coordinates 1401107..1401358 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9782_RS06155 (M9782_06155) 1396658..1397140 + 483 WP_029367525.1 GNAT family N-acetyltransferase -
M9782_RS06160 (M9782_06160) 1397186..1397812 - 627 WP_039355520.1 LysE family transporter -
M9782_RS06165 (M9782_06165) 1398046..1398534 - 489 WP_275071909.1 hypothetical protein -
M9782_RS06170 (M9782_06170) 1398800..1399378 - 579 WP_275071910.1 hypothetical protein -
M9782_RS06175 (M9782_06175) 1399525..1399647 - 123 Protein_1194 integrase -
M9782_RS06180 (M9782_06180) 1400016..1400531 - 516 WP_039355527.1 GNAT family N-acetyltransferase -
M9782_RS06185 (M9782_06185) 1400533..1400799 - 267 WP_039355529.1 DUF1778 domain-containing protein -
M9782_RS06190 (M9782_06190) 1400980..1401117 - 138 WP_275071911.1 hypothetical protein Toxin
M9782_RS06195 (M9782_06195) 1401107..1401358 - 252 WP_275071912.1 prevent-host-death protein Antitoxin
M9782_RS06200 (M9782_06200) 1401488..1401958 + 471 WP_275071913.1 hypothetical protein -
M9782_RS06205 (M9782_06205) 1401958..1402287 + 330 WP_234991477.1 DUF1493 family protein -
M9782_RS06210 (M9782_06210) 1402357..1402530 - 174 Protein_1201 primase-like DNA-binding domain-containing protein -
M9782_RS06215 (M9782_06215) 1403034..1403789 + 756 WP_275071914.1 capsid size determination protein -
M9782_RS06220 (M9782_06220) 1403786..1404034 + 249 WP_275071915.1 ogr/Delta-like zinc finger family protein -
M9782_RS06225 (M9782_06225) 1404295..1406070 - 1776 WP_275071916.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 46 a.a.        Molecular weight: 5297.17 Da        Isoelectric Point: 9.1267

>T246521 WP_275071911.1 NZ_CP097896:c1401117-1400980 [Pectobacterium actinidiae]
MSYKLEFEEHALKEFKKLSAPMREQFTKSCKVMSNSSPVHQLITH

Download         Length: 138 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9108.35 Da        Isoelectric Point: 5.0644

>AT246521 WP_275071912.1 NZ_CP097896:c1401358-1401107 [Pectobacterium actinidiae]
MSVQPILANAAVSISDFKKSPNAALKEANGEPVAVLTNGRISGYYFSPETWEALADYQEDIELAKIAHSRMKGKRVKVDL
DEL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References