Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1301223..1301883 | Replicon | chromosome |
Accession | NZ_CP097896 | ||
Organism | Pectobacterium actinidiae strain GX-Pa1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A1V2R8T2 |
Locus tag | M9782_RS05795 | Protein ID | WP_039355399.1 |
Coordinates | 1301470..1301883 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A1V2R9A9 |
Locus tag | M9782_RS05790 | Protein ID | WP_039355397.1 |
Coordinates | 1301223..1301489 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9782_RS05770 (M9782_05770) | 1297355..1298359 | - | 1005 | WP_275071868.1 | substrate-binding domain-containing protein | - |
M9782_RS05775 (M9782_05775) | 1298414..1299022 | - | 609 | WP_039355390.1 | HD domain-containing protein | - |
M9782_RS05780 (M9782_05780) | 1299284..1299931 | + | 648 | WP_275071869.1 | hemolysin III family protein | - |
M9782_RS05785 (M9782_05785) | 1299986..1300987 | - | 1002 | WP_151242992.1 | tRNA-modifying protein YgfZ | - |
M9782_RS05790 (M9782_05790) | 1301223..1301489 | + | 267 | WP_039355397.1 | FAD assembly factor SdhE | Antitoxin |
M9782_RS05795 (M9782_05795) | 1301470..1301883 | + | 414 | WP_039355399.1 | protein YgfX | Toxin |
M9782_RS05800 (M9782_05800) | 1301951..1302886 | + | 936 | WP_275071870.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
M9782_RS05805 (M9782_05805) | 1302952..1303275 | - | 324 | WP_275071871.1 | hypothetical protein | - |
M9782_RS05810 (M9782_05810) | 1303304..1303822 | - | 519 | WP_039355405.1 | flavodoxin FldB | - |
M9782_RS05815 (M9782_05815) | 1304164..1304550 | - | 387 | WP_039355407.1 | thioesterase family protein | - |
M9782_RS05820 (M9782_05820) | 1304737..1306065 | - | 1329 | WP_039355408.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16283.21 Da Isoelectric Point: 10.5525
>T246520 WP_039355399.1 NZ_CP097896:1301470-1301883 [Pectobacterium actinidiae]
VAQWQCDLRVSWRMQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQ
EWQIVKRPWLLKNGVLLSLQAVNGKDKQQLWLASDSMGDDEWRHLRQLLLQQKHWAR
VAQWQCDLRVSWRMQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQ
EWQIVKRPWLLKNGVLLSLQAVNGKDKQQLWLASDSMGDDEWRHLRQLLLQQKHWAR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V2R8T2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V2R9A9 |