Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1137371..1137897 | Replicon | chromosome |
Accession | NZ_CP097896 | ||
Organism | Pectobacterium actinidiae strain GX-Pa1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | M9782_RS05035 | Protein ID | WP_275071809.1 |
Coordinates | 1137371..1137676 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | M9782_RS05040 | Protein ID | WP_275071810.1 |
Coordinates | 1137679..1137897 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9782_RS05025 (M9782_05025) | 1134026..1135975 | + | 1950 | WP_275071807.1 | helicase-related protein | - |
M9782_RS05030 (M9782_05030) | 1135977..1137236 | + | 1260 | WP_275071808.1 | GIY-YIG nuclease family protein | - |
M9782_RS05035 (M9782_05035) | 1137371..1137676 | - | 306 | WP_275071809.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M9782_RS05040 (M9782_05040) | 1137679..1137897 | - | 219 | WP_275071810.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M9782_RS05045 (M9782_05045) | 1137956..1138699 | - | 744 | WP_275071811.1 | MobC family replication-relaxation protein | - |
M9782_RS05050 (M9782_05050) | 1139611..1139952 | - | 342 | WP_038917757.1 | hypothetical protein | - |
M9782_RS05055 (M9782_05055) | 1140093..1140263 | + | 171 | WP_162847981.1 | hypothetical protein | - |
M9782_RS05060 (M9782_05060) | 1140404..1141663 | - | 1260 | WP_275071812.1 | integrase arm-type DNA-binding domain-containing protein | - |
M9782_RS05070 (M9782_05070) | 1142027..1142602 | - | 576 | WP_010301517.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1124675..1141840 | 17165 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11634.60 Da Isoelectric Point: 4.6508
>T246519 WP_275071809.1 NZ_CP097896:c1137676-1137371 [Pectobacterium actinidiae]
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMAIPLIEAHHLSEKVNKMLFPLICIDGEDYRLMTTELSSVPVEVIGEVI
ADLGDCADEIKDAINLMFWGI
MQFIVYQYKRASHYKMFVDVQSDIVETPKRRMAIPLIEAHHLSEKVNKMLFPLICIDGEDYRLMTTELSSVPVEVIGEVI
ADLGDCADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|