Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-DnaT |
Location | 868938..869469 | Replicon | chromosome |
Accession | NZ_CP097896 | ||
Organism | Pectobacterium actinidiae strain GX-Pa1 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | M9782_RS03905 | Protein ID | WP_275071690.1 |
Coordinates | 869182..869469 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A1V2R9J2 |
Locus tag | M9782_RS03900 | Protein ID | WP_039282788.1 |
Coordinates | 868938..869192 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9782_RS03875 (M9782_03875) | 864043..864633 | - | 591 | WP_005975525.1 | DnaA initiator-associating protein DiaA | - |
M9782_RS03880 (M9782_03880) | 864686..865042 | - | 357 | WP_039279491.1 | YraN family protein | - |
M9782_RS03885 (M9782_03885) | 865039..867057 | - | 2019 | WP_275071689.1 | penicillin-binding protein activator | - |
M9782_RS03890 (M9782_03890) | 867119..868006 | + | 888 | WP_039354667.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
M9782_RS03900 (M9782_03900) | 868938..869192 | + | 255 | WP_039282788.1 | plasmid stabilization protein | Antitoxin |
M9782_RS03905 (M9782_03905) | 869182..869469 | + | 288 | WP_275071690.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9782_RS03910 (M9782_03910) | 869646..870434 | + | 789 | WP_275071691.1 | 4,5-DOPA dioxygenase extradiol | - |
M9782_RS03915 (M9782_03915) | 870565..871962 | - | 1398 | WP_275072370.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11011.96 Da Isoelectric Point: 10.7694
>T246515 WP_275071690.1 NZ_CP097896:869182-869469 [Pectobacterium actinidiae]
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLVERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLIQDETITVMVMGVGK
REGSQVYSDTKGRSA
MTYKLKFVPSAMKEWKKLGHPVREQFKKKLVERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLIQDETITVMVMGVGK
REGSQVYSDTKGRSA
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|