Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 591286..591821 | Replicon | chromosome |
Accession | NZ_CP097896 | ||
Organism | Pectobacterium actinidiae strain GX-Pa1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1V2R154 |
Locus tag | M9782_RS02590 | Protein ID | WP_039363923.1 |
Coordinates | 591286..591573 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M9782_RS02595 | Protein ID | WP_275071591.1 |
Coordinates | 591570..591821 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9782_RS02575 (M9782_02575) | 587922..588650 | - | 729 | WP_275071588.1 | DUF1266 domain-containing protein | - |
M9782_RS02580 (M9782_02580) | 588869..589711 | + | 843 | WP_275071589.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
M9782_RS02585 (M9782_02585) | 589840..591192 | + | 1353 | WP_275071590.1 | glutathione-disulfide reductase | - |
M9782_RS02590 (M9782_02590) | 591286..591573 | - | 288 | WP_039363923.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9782_RS02595 (M9782_02595) | 591570..591821 | - | 252 | WP_275071591.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M9782_RS02600 (M9782_02600) | 592076..592981 | + | 906 | WP_275071592.1 | siderophore-interacting protein | - |
M9782_RS02605 (M9782_02605) | 593016..593771 | - | 756 | WP_275071593.1 | thiol:disulfide interchange protein DsbG | - |
M9782_RS02610 (M9782_02610) | 594044..594667 | + | 624 | WP_275071594.1 | LysE family translocator | - |
M9782_RS02615 (M9782_02615) | 594727..595767 | - | 1041 | WP_275071595.1 | HipA domain-containing protein | - |
M9782_RS02620 (M9782_02620) | 595764..596078 | - | 315 | WP_275071596.1 | HipA N-terminal domain-containing protein | - |
M9782_RS02625 (M9782_02625) | 596063..596389 | - | 327 | WP_039363945.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11130.22 Da Isoelectric Point: 10.3856
>T246513 WP_039363923.1 NZ_CP097896:c591573-591286 [Pectobacterium actinidiae]
MSYRVKFREDALKEWLKLDKTIQQQFAKKLKKCCENPHIPSAKLRGMKDCYKITLRASGFRLVYEIIDDILVIAVVAVGK
RERSGVYHLASERMR
MSYRVKFREDALKEWLKLDKTIQQQFAKKLKKCCENPHIPSAKLRGMKDCYKITLRASGFRLVYEIIDDILVIAVVAVGK
RERSGVYHLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|