Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1271658..1272575 | Replicon | chromosome |
Accession | NZ_CP097895 | ||
Organism | Bacillus velezensis strain B1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | M8561_RS06515 | Protein ID | WP_003154806.1 |
Coordinates | 1271829..1272575 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M8561_RS06510 | Protein ID | WP_003154807.1 |
Coordinates | 1271658..1271828 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M8561_RS06470 (M8561_06470) | 1266890..1268512 | + | 1623 | WP_024085192.1 | pyocin knob domain-containing protein | - |
M8561_RS06475 (M8561_06475) | 1268525..1268896 | + | 372 | WP_024085193.1 | XkdW family protein | - |
M8561_RS06480 (M8561_06480) | 1268902..1269099 | + | 198 | WP_003154819.1 | XkdX family protein | - |
M8561_RS06485 (M8561_06485) | 1269156..1269917 | + | 762 | WP_024085194.1 | hypothetical protein | - |
M8561_RS06490 (M8561_06490) | 1269969..1270232 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M8561_RS06495 (M8561_06495) | 1270246..1270509 | + | 264 | WP_003154813.1 | phage holin | - |
M8561_RS06500 (M8561_06500) | 1270523..1271401 | + | 879 | WP_024085195.1 | N-acetylmuramoyl-L-alanine amidase | - |
M8561_RS06505 (M8561_06505) | 1271436..1271561 | - | 126 | WP_003154809.1 | hypothetical protein | - |
M8561_RS06510 (M8561_06510) | 1271658..1271828 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M8561_RS06515 (M8561_06515) | 1271829..1272575 | - | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M8561_RS06520 (M8561_06520) | 1272680..1273678 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
M8561_RS06525 (M8561_06525) | 1273691..1274308 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
M8561_RS06530 (M8561_06530) | 1274594..1275910 | - | 1317 | WP_003154801.1 | amino acid permease | - |
M8561_RS06535 (M8561_06535) | 1276234..1277184 | + | 951 | WP_024085196.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1227867..1329934 | 102067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T246512 WP_003154806.1 NZ_CP097895:c1272575-1271829 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A8LGT8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |