Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 508624..509261 | Replicon | chromosome |
| Accession | NZ_CP097895 | ||
| Organism | Bacillus velezensis strain B1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | M8561_RS02455 | Protein ID | WP_003156187.1 |
| Coordinates | 508911..509261 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | M8561_RS02450 | Protein ID | WP_003156188.1 |
| Coordinates | 508624..508905 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8561_RS02430 (M8561_02430) | 504989..505588 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| M8561_RS02435 (M8561_02435) | 505681..506046 | + | 366 | WP_003156192.1 | holo-ACP synthase | - |
| M8561_RS02440 (M8561_02440) | 506211..507218 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
| M8561_RS02445 (M8561_02445) | 507335..508504 | + | 1170 | WP_003156189.1 | alanine racemase | - |
| M8561_RS02450 (M8561_02450) | 508624..508905 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| M8561_RS02455 (M8561_02455) | 508911..509261 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M8561_RS02460 (M8561_02460) | 509379..510200 | + | 822 | WP_014304404.1 | STAS domain-containing protein | - |
| M8561_RS02465 (M8561_02465) | 510205..510570 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| M8561_RS02470 (M8561_02470) | 510573..510974 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| M8561_RS02475 (M8561_02475) | 510986..511993 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
| M8561_RS02480 (M8561_02480) | 512057..512386 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| M8561_RS02485 (M8561_02485) | 512383..512865 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
| M8561_RS02490 (M8561_02490) | 512831..513619 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| M8561_RS02495 (M8561_02495) | 513619..514221 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T246511 WP_003156187.1 NZ_CP097895:508911-509261 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|