Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 914606..915132 | Replicon | chromosome |
| Accession | NZ_CP097887 | ||
| Organism | Staphylococcus arlettae strain SA283 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7V7SNP8 |
| Locus tag | NAA64_RS04340 | Protein ID | WP_002509017.1 |
| Coordinates | 914776..915132 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A7V7VEP5 |
| Locus tag | NAA64_RS04335 | Protein ID | WP_002509016.1 |
| Coordinates | 914606..914776 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAA64_RS04310 (NAA64_04310) | 910433..910906 | + | 474 | WP_002509011.1 | hypothetical protein | - |
| NAA64_RS04315 (NAA64_04315) | 910899..912395 | + | 1497 | WP_167868166.1 | PH domain-containing protein | - |
| NAA64_RS04320 (NAA64_04320) | 912388..912861 | + | 474 | WP_021459211.1 | PH domain-containing protein | - |
| NAA64_RS04325 (NAA64_04325) | 912904..913257 | + | 354 | WP_002509014.1 | holo-ACP synthase | - |
| NAA64_RS04330 (NAA64_04330) | 913369..914517 | + | 1149 | WP_002509015.1 | alanine racemase | - |
| NAA64_RS04335 (NAA64_04335) | 914606..914776 | + | 171 | WP_002509016.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NAA64_RS04340 (NAA64_04340) | 914776..915132 | + | 357 | WP_002509017.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NAA64_RS04345 (NAA64_04345) | 915404..916405 | + | 1002 | WP_103387740.1 | PP2C family protein-serine/threonine phosphatase | - |
| NAA64_RS04350 (NAA64_04350) | 916488..916814 | + | 327 | WP_002509019.1 | anti-sigma factor antagonist | - |
| NAA64_RS04355 (NAA64_04355) | 916816..917295 | + | 480 | WP_002509020.1 | anti-sigma B factor RsbW | - |
| NAA64_RS04360 (NAA64_04360) | 917270..918040 | + | 771 | WP_103387739.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13385.57 Da Isoelectric Point: 10.2885
>T246510 WP_002509017.1 NZ_CP097887:914776-915132 [Staphylococcus arlettae]
MRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRT
LDKKRLKEKLTYLSEDKMKEVNIAIDISLGLHNNRHHK
MRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRT
LDKKRLKEKLTYLSEDKMKEVNIAIDISLGLHNNRHHK
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7SNP8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V7VEP5 |