Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1392053..1392711 Replicon chromosome
Accession NZ_CP097885
Organism Peptoniphilus sp. SAHP1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag M9426_RS06665 Protein ID WP_148465273.1
Coordinates 1392053..1392238 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag M9426_RS06670 Protein ID WP_148465274.1
Coordinates 1392271..1392711 (+) Length 147 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9426_RS06620 (M9426_06610) 1387706..1388173 + 468 WP_250341734.1 hypothetical protein -
M9426_RS06625 (M9426_06615) 1388257..1388931 + 675 WP_250341735.1 hypothetical protein -
M9426_RS06630 (M9426_06620) 1389040..1389366 + 327 WP_250341736.1 hypothetical protein -
M9426_RS06635 (M9426_06625) 1389368..1390117 + 750 WP_250341737.1 N-acetylmuramoyl-L-alanine amidase -
M9426_RS06640 (M9426_06630) 1390119..1390505 + 387 WP_250341738.1 phage holin family protein -
M9426_RS06645 (M9426_06635) 1390492..1390800 + 309 WP_250341739.1 phage holin, LLH family -
M9426_RS06650 (M9426_06640) 1390807..1391064 + 258 WP_250341740.1 hypothetical protein -
M9426_RS06655 (M9426_06645) 1391352..1391555 + 204 WP_250341741.1 hypothetical protein -
M9426_RS06665 (M9426_06655) 1392053..1392238 + 186 WP_148465273.1 type II toxin-antitoxin system HicA family toxin Toxin
M9426_RS06670 (M9426_06660) 1392271..1392711 + 441 WP_148465274.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M9426_RS06675 (M9426_06665) 1393044..1393874 + 831 WP_148465275.1 glutamate racemase -
M9426_RS06680 (M9426_06670) 1393893..1394675 - 783 WP_250341742.1 type III pantothenate kinase -
M9426_RS06685 (M9426_06675) 1394677..1395426 - 750 WP_250341743.1 ECF transporter S component -
M9426_RS06690 (M9426_06680) 1395476..1396438 - 963 WP_250341744.1 P1 family peptidase -
M9426_RS06695 (M9426_06685) 1396621..1396932 - 312 WP_060799474.1 MTH1187 family thiamine-binding protein -
M9426_RS06700 (M9426_06690) 1396943..1397590 - 648 WP_250341745.1 trimeric intracellular cation channel family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1353085..1392711 39626


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-60)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-75)


Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6767.18 Da        Isoelectric Point: 10.9610

>T246508 WP_148465273.1 NZ_CP097885:1392053-1392238 [Peptoniphilus sp. SAHP1]
MPMTQDEMVKLLRKNGFEVVKGGKGSHIKMTKLGIKRPIIIPHGELQKGTERGILKEAGLK

Download         Length: 186 bp

Antitoxin


Download         Length: 147 a.a.        Molecular weight: 16232.26 Da        Isoelectric Point: 3.9544

>AT246508 WP_148465274.1 NZ_CP097885:1392271-1392711 [Peptoniphilus sp. SAHP1]
MLVSYPAIFYYSPEEKGYYVYMPDIGGAGTQGNSIEEALLMASDYLGIMASSIIEGGDTLPKQSAISDLSIEDDFPFKDD
DDFDGFYDYSKSFVSLVYVDLKDYLGSQELVKKTLSIPKWSNDLGNKLNLNFSKLLTEAIVNIAKN

Download         Length: 441 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References