Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 4279576..4280255 | Replicon | chromosome |
| Accession | NZ_CP097884 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | NAG72_RS20885 | Protein ID | WP_000854672.1 |
| Coordinates | 4279914..4280255 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | NAG72_RS20880 | Protein ID | WP_000070395.1 |
| Coordinates | 4279576..4279893 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG72_RS20830 (4274623) | 4274623..4275486 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| NAG72_RS20835 (4275578) | 4275578..4276399 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| NAG72_RS20840 (4276616) | 4276616..4276807 | + | 192 | Protein_4054 | DeoR family transcriptional regulator | - |
| NAG72_RS20845 (4276854) | 4276854..4277030 | + | 177 | WP_001285112.1 | hypothetical protein | - |
| NAG72_RS20850 (4277030) | 4277030..4277473 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| NAG72_RS20855 (4277496) | 4277496..4277963 | + | 468 | WP_001547765.1 | protein YkfB | - |
| NAG72_RS20860 (4278040) | 4278040..4278279 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| NAG72_RS20865 (4278377) | 4278377..4278835 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| NAG72_RS20870 (4278851) | 4278851..4279327 | + | 477 | WP_000811693.1 | RadC family protein | - |
| NAG72_RS20875 (4279336) | 4279336..4279557 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| NAG72_RS20880 (4279576) | 4279576..4279893 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| NAG72_RS20885 (4279914) | 4279914..4280255 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| NAG72_RS20895 (4280827) | 4280827..4282080 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| NAG72_RS20900 (4282092) | 4282092..4283195 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| NAG72_RS20905 (4283483) | 4283483..4284538 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| NAG72_RS20910 (4284577) | 4284577..4284978 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T246504 WP_000854672.1 NZ_CP097884:4279914-4280255 [Escherichia coli str. K-12 substr. MG1655]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11939.59 Da Isoelectric Point: 6.7391
>AT246504 WP_000070395.1 NZ_CP097884:4279576-4279893 [Escherichia coli str. K-12 substr. MG1655]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|