Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2983489..2984127 | Replicon | chromosome |
Accession | NZ_CP097884 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NAG72_RS14355 | Protein ID | WP_000813794.1 |
Coordinates | 2983951..2984127 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NAG72_RS14350 | Protein ID | WP_001270286.1 |
Coordinates | 2983489..2983905 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG72_RS14330 (2978641) | 2978641..2979582 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
NAG72_RS14335 (2979583) | 2979583..2980596 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NAG72_RS14340 (2980614) | 2980614..2981759 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NAG72_RS14345 (2982004) | 2982004..2983410 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NAG72_RS14350 (2983489) | 2983489..2983905 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NAG72_RS14355 (2983951) | 2983951..2984127 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NAG72_RS14360 (2984349) | 2984349..2984579 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NAG72_RS14365 (2984671) | 2984671..2986632 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NAG72_RS14370 (2986705) | 2986705..2987241 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NAG72_RS14375 (2987294) | 2987294..2988508 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T246502 WP_000813794.1 NZ_CP097884:c2984127-2983951 [Escherichia coli str. K-12 substr. MG1655]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT246502 WP_001270286.1 NZ_CP097884:c2983905-2983489 [Escherichia coli str. K-12 substr. MG1655]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|