Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2358074..2358712 | Replicon | chromosome |
Accession | NZ_CP097883 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NAG71_RS11415 | Protein ID | WP_000813794.1 |
Coordinates | 2358536..2358712 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NAG71_RS11410 | Protein ID | WP_001270286.1 |
Coordinates | 2358074..2358490 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG71_RS11390 (2353226) | 2353226..2354167 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
NAG71_RS11395 (2354168) | 2354168..2355181 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NAG71_RS11400 (2355199) | 2355199..2356344 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NAG71_RS11405 (2356589) | 2356589..2357995 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NAG71_RS11410 (2358074) | 2358074..2358490 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NAG71_RS11415 (2358536) | 2358536..2358712 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NAG71_RS11420 (2358934) | 2358934..2359164 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NAG71_RS11425 (2359256) | 2359256..2361217 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NAG71_RS11430 (2361290) | 2361290..2361826 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NAG71_RS11435 (2361918) | 2361918..2363093 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T246475 WP_000813794.1 NZ_CP097883:c2358712-2358536 [Escherichia coli str. K-12 substr. MG1655]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT246475 WP_001270286.1 NZ_CP097883:c2358490-2358074 [Escherichia coli str. K-12 substr. MG1655]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|