Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 973591..974174 | Replicon | chromosome |
Accession | NZ_CP097883 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NAG71_RS04665 | Protein ID | WP_000254738.1 |
Coordinates | 973839..974174 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NAG71_RS04660 | Protein ID | WP_000581937.1 |
Coordinates | 973591..973839 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG71_RS04650 (969930) | 969930..971231 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NAG71_RS04655 (971279) | 971279..973513 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NAG71_RS04660 (973591) | 973591..973839 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NAG71_RS04665 (973839) | 973839..974174 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NAG71_RS04670 (974245) | 974245..975036 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NAG71_RS04675 (975264) | 975264..976901 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NAG71_RS04680 (976989) | 976989..978287 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T246464 WP_000254738.1 NZ_CP097883:973839-974174 [Escherichia coli str. K-12 substr. MG1655]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|