Detailed information of TA system
Overview
TA module
| Type | V | Classification (family/domain) | ghoTS/ghoT-GhoS |
| Location | 4204613..4205110 | Replicon | chromosome |
| Accession | NZ_CP097882 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ghoT | Uniprot ID | L4JJG6 |
| Locus tag | NAG70_RS20615 | Protein ID | WP_001173343.1 |
| Coordinates | 4204613..4204786 (-) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | ghoS | Uniprot ID | L4JK92 |
| Locus tag | NAG70_RS20620 | Protein ID | WP_000398619.1 |
| Coordinates | 4204814..4205110 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG70_RS20605 (4201283) | 4201283..4202740 | + | 1458 | WP_000856829.1 | dipeptide/tripeptide permease DtpC | - |
| NAG70_RS20610 (4202977) | 4202977..4204494 | + | 1518 | WP_001295074.1 | lysine--tRNA ligase | - |
| NAG70_RS20615 (4204613) | 4204613..4204786 | - | 174 | WP_001173343.1 | type V toxin-antitoxin system toxin GhoT | Toxin |
| NAG70_RS20620 (4204814) | 4204814..4205110 | - | 297 | WP_000398619.1 | type V toxin-antitoxin system endoribonuclease antitoxin GhoS | Antitoxin |
| NAG70_RS20625 (4205337) | 4205337..4205609 | - | 273 | WP_000405651.1 | GNAT family N-acetyltransferase | - |
| NAG70_RS20630 (4205621) | 4205621..4205851 | - | 231 | WP_000371704.1 | 4Fe-4S mono-cluster protein YjdI | - |
| NAG70_RS20635 (4206032) | 4206032..4207663 | + | 1632 | WP_001216477.1 | sensor histidine kinase | - |
| NAG70_RS20640 (4207660) | 4207660..4208379 | + | 720 | WP_000611288.1 | two-component system response regulator DcuR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6555.06 Da Isoelectric Point: 10.2288
>T246458 WP_001173343.1 NZ_CP097882:c4204786-4204613 [Escherichia coli str. K-12 substr. MG1655]
MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWPMSLPVALLFSLF
MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWPMSLPVALLFSLF
Download Length: 174 bp
Antitoxin
Download Length: 99 a.a. Molecular weight: 11467.97 Da Isoelectric Point: 4.1705
>AT246458 WP_000398619.1 NZ_CP097882:c4205110-4204814 [Escherichia coli str. K-12 substr. MG1655]
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDI
DFDLNIMTVDDYFRQFYK
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDI
DFDLNIMTVDDYFRQFYK
Download Length: 297 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QI41 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2LLZ | |
| AlphaFold DB | A0A7U9QBH6 |