Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3652812..3653491 | Replicon | chromosome |
| Accession | NZ_CP097882 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | NAG70_RS17940 | Protein ID | WP_000854672.1 |
| Coordinates | 3653150..3653491 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | NAG70_RS17935 | Protein ID | WP_000070395.1 |
| Coordinates | 3652812..3653129 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG70_RS17885 (3647859) | 3647859..3648722 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| NAG70_RS17890 (3648814) | 3648814..3649635 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| NAG70_RS17895 (3649852) | 3649852..3650043 | + | 192 | Protein_3497 | DeoR family transcriptional regulator | - |
| NAG70_RS17900 (3650090) | 3650090..3650266 | + | 177 | WP_001285112.1 | hypothetical protein | - |
| NAG70_RS17905 (3650266) | 3650266..3650709 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| NAG70_RS17910 (3650732) | 3650732..3651199 | + | 468 | WP_001547765.1 | protein YkfB | - |
| NAG70_RS17915 (3651276) | 3651276..3651515 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| NAG70_RS17920 (3651613) | 3651613..3652071 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| NAG70_RS17925 (3652087) | 3652087..3652563 | + | 477 | WP_000811693.1 | RadC family protein | - |
| NAG70_RS17930 (3652572) | 3652572..3652793 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| NAG70_RS17935 (3652812) | 3652812..3653129 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| NAG70_RS17940 (3653150) | 3653150..3653491 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| NAG70_RS17950 (3654063) | 3654063..3655316 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| NAG70_RS17955 (3655328) | 3655328..3656431 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| NAG70_RS17960 (3656719) | 3656719..3657774 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| NAG70_RS17965 (3657813) | 3657813..3658214 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T246451 WP_000854672.1 NZ_CP097882:3653150-3653491 [Escherichia coli str. K-12 substr. MG1655]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11939.59 Da Isoelectric Point: 6.7391
>AT246451 WP_000070395.1 NZ_CP097882:3652812-3653129 [Escherichia coli str. K-12 substr. MG1655]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|