Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1790831..1791662 | Replicon | chromosome |
| Accession | NZ_CP097882 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | NAG70_RS08520 | Protein ID | WP_000854814.1 |
| Coordinates | 1790831..1791205 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | NAG70_RS08525 | Protein ID | WP_001285584.1 |
| Coordinates | 1791294..1791662 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG70_RS08480 (1786227) | 1786227..1787393 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| NAG70_RS08485 (1787512) | 1787512..1787985 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| NAG70_RS08490 (1788183) | 1788183..1789241 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| NAG70_RS08495 (1789413) | 1789413..1789742 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NAG70_RS08500 (1789843) | 1789843..1789977 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| NAG70_RS08505 (1790097) | 1790097..1790225 | + | 129 | Protein_1660 | transposase domain-containing protein | - |
| NAG70_RS08510 (1790514) | 1790514..1790594 | - | 81 | Protein_1661 | hypothetical protein | - |
| NAG70_RS08515 (1790640) | 1790640..1790834 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NAG70_RS08520 (1790831) | 1790831..1791205 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NAG70_RS08525 (1791294) | 1791294..1791662 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NAG70_RS08530 (1791736) | 1791736..1791957 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NAG70_RS08535 (1792020) | 1792020..1792466 | - | 447 | WP_000187523.1 | RadC family protein | - |
| NAG70_RS08540 (1792463) | 1792463..1793995 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T246442 WP_000854814.1 NZ_CP097882:c1791205-1790831 [Escherichia coli str. K-12 substr. MG1655]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT246442 WP_001285584.1 NZ_CP097882:c1791662-1791294 [Escherichia coli str. K-12 substr. MG1655]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |