Detailed information of TA system
Overview
TA module
| Type | V | Classification (family/domain) | ghoTS/ghoT-GhoS |
| Location | 4133814..4134311 | Replicon | chromosome |
| Accession | NZ_CP097881 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ghoT | Uniprot ID | L4JJG6 |
| Locus tag | NAG69_RS20145 | Protein ID | WP_001173343.1 |
| Coordinates | 4133814..4133987 (-) | Length | 58 a.a. |
Antitoxin (Protein)
| Gene name | ghoS | Uniprot ID | L4JK92 |
| Locus tag | NAG69_RS20150 | Protein ID | WP_000398619.1 |
| Coordinates | 4134015..4134311 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG69_RS20135 (4130484) | 4130484..4131941 | + | 1458 | WP_000856829.1 | dipeptide/tripeptide permease DtpC | - |
| NAG69_RS20140 (4132178) | 4132178..4133695 | + | 1518 | WP_001295074.1 | lysine--tRNA ligase | - |
| NAG69_RS20145 (4133814) | 4133814..4133987 | - | 174 | WP_001173343.1 | type V toxin-antitoxin system toxin GhoT | Toxin |
| NAG69_RS20150 (4134015) | 4134015..4134311 | - | 297 | WP_000398619.1 | type V toxin-antitoxin system endoribonuclease antitoxin GhoS | Antitoxin |
| NAG69_RS20155 (4134538) | 4134538..4134810 | - | 273 | WP_000405651.1 | GNAT family N-acetyltransferase | - |
| NAG69_RS20160 (4134822) | 4134822..4135052 | - | 231 | WP_000371704.1 | 4Fe-4S mono-cluster protein YjdI | - |
| NAG69_RS20165 (4135233) | 4135233..4136864 | + | 1632 | WP_001216477.1 | sensor histidine kinase | - |
| NAG69_RS20170 (4136861) | 4136861..4137580 | + | 720 | WP_000611288.1 | two-component system response regulator DcuR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6555.06 Da Isoelectric Point: 10.2288
>T246432 WP_001173343.1 NZ_CP097881:c4133987-4133814 [Escherichia coli str. K-12 substr. MG1655]
MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWPMSLPVALLFSLF
MALFSKILIFYVIGVNISFVIIWFISHEKTHIRLLSAFLVGITWPMSLPVALLFSLF
Download Length: 174 bp
Antitoxin
Download Length: 99 a.a. Molecular weight: 11467.97 Da Isoelectric Point: 4.1705
>AT246432 WP_000398619.1 NZ_CP097881:c4134311-4134015 [Escherichia coli str. K-12 substr. MG1655]
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDI
DFDLNIMTVDDYFRQFYK
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTSLAASEIEDLIRLKCLDLPDI
DFDLNIMTVDDYFRQFYK
Download Length: 297 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QI41 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2LLZ | |
| AlphaFold DB | A0A7U9QBH6 |