Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3582013..3582692 | Replicon | chromosome |
| Accession | NZ_CP097881 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | NAG69_RS17470 | Protein ID | WP_000854672.1 |
| Coordinates | 3582351..3582692 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | NAG69_RS17465 | Protein ID | WP_000070395.1 |
| Coordinates | 3582013..3582330 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG69_RS17415 (3577060) | 3577060..3577923 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| NAG69_RS17420 (3578015) | 3578015..3578836 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| NAG69_RS17425 (3579053) | 3579053..3579244 | + | 192 | Protein_3403 | DeoR family transcriptional regulator | - |
| NAG69_RS17430 (3579291) | 3579291..3579467 | + | 177 | WP_001285112.1 | hypothetical protein | - |
| NAG69_RS17435 (3579467) | 3579467..3579910 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| NAG69_RS17440 (3579933) | 3579933..3580400 | + | 468 | WP_001547765.1 | protein YkfB | - |
| NAG69_RS17445 (3580477) | 3580477..3580716 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| NAG69_RS17450 (3580814) | 3580814..3581272 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| NAG69_RS17455 (3581288) | 3581288..3581764 | + | 477 | WP_000811693.1 | RadC family protein | - |
| NAG69_RS17460 (3581773) | 3581773..3581994 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| NAG69_RS17465 (3582013) | 3582013..3582330 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| NAG69_RS17470 (3582351) | 3582351..3582692 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| NAG69_RS17480 (3583264) | 3583264..3584517 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| NAG69_RS17485 (3584529) | 3584529..3585632 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| NAG69_RS17490 (3585920) | 3585920..3586975 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| NAG69_RS17495 (3587014) | 3587014..3587415 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T246425 WP_000854672.1 NZ_CP097881:3582351-3582692 [Escherichia coli str. K-12 substr. MG1655]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11939.59 Da Isoelectric Point: 6.7391
>AT246425 WP_000070395.1 NZ_CP097881:3582013-3582330 [Escherichia coli str. K-12 substr. MG1655]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|