Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2373027..2373665 | Replicon | chromosome |
| Accession | NZ_CP097881 | ||
| Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NAG69_RS11505 | Protein ID | WP_000813794.1 |
| Coordinates | 2373489..2373665 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NAG69_RS11500 | Protein ID | WP_001270286.1 |
| Coordinates | 2373027..2373443 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAG69_RS11480 (2368179) | 2368179..2369120 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| NAG69_RS11485 (2369121) | 2369121..2370134 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NAG69_RS11490 (2370152) | 2370152..2371297 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| NAG69_RS11495 (2371542) | 2371542..2372948 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| NAG69_RS11500 (2373027) | 2373027..2373443 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NAG69_RS11505 (2373489) | 2373489..2373665 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NAG69_RS11510 (2373887) | 2373887..2374117 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NAG69_RS11515 (2374209) | 2374209..2376170 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NAG69_RS11520 (2376243) | 2376243..2376779 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NAG69_RS11525 (2376871) | 2376871..2378046 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T246423 WP_000813794.1 NZ_CP097881:c2373665-2373489 [Escherichia coli str. K-12 substr. MG1655]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT246423 WP_001270286.1 NZ_CP097881:c2373443-2373027 [Escherichia coli str. K-12 substr. MG1655]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|